Diffraction data quality metrics of PDB entries harvested from archived mmCIF files - ordered by Model building software
(20240523 PDB release, aB_cif2table1 from BUSTER refinement package, Global Phasing Ltd.)

2CMR2DXABSALMNALMN/CCP4AMOLEAMoREAPRVARPARP/wARP
ASCALCAUTOMARAUTOMRAVGSYSAccelrysAgrovataAutoAutoBuildAutoSolBALBES
BASEDBAZFAZBEASTBIOMOLBLANCBP3BRICOGNEBRICOGNE'SBRUTEBUCCANEER
BUSTER-TNTBacillusCCP$CCP4CCP4/OCCP4:CCP4ICHAINCHAINSAWCNS
COMPLEXCOOCROQUECRUNCH2CaspRCootDAREFIDEMONDEMON-ANGELDENMOD
DFDIFFERENCEDIMPLEDJFDMDMMultiDPHASEEDENEDPDBELVES
ENVATENVELOPEESSENSFASTRANFFFEARFFTFFTBIGFRFSUMFRODOFROFFT
GAPGETAXGROPATHASSPHEAVYHELICAPHKL2MapHYSS/RESOLVEILMILIONEILMLIONE
INTERPOLATEISASISAS2001ISIRASISOLDEISOMORPHOUSIlIlMilioneInsight IILAFIRE
LATLINELOCALLOCHVATLYNNMADMAD-SIRMADIRAMADLSQMADPHSREFMADPRB
MAGICSQUASHMAINMAMAMAVEMFTMGRMICEMIRMIRASMIRPHS
MLPHAREMOLEMAN2MOLREPMRCMRCHKMRXMTF/ULTIMAMULTIPLEMoRDaMol
MolProbityMoppreMrBUMPMrBump/MolrepN/NANANtMRFNCSMASKNCSREFNotO
OASISPARROTPATSOLPDB-REDOPERONPHAREPHASEPHASERPHASES-95PHASIT
PHENIXPHENIX-AUTOSOLPHENIX-AutoSolPHENIX/AutoSOLPOLARRFNPROLSQ/PROFFTPROTEINPROTSYSPURDUEPYMOL
PattersonPhenix-AutoSolQuantaRANTANRAPDRASMOLRAVEREFMACREMOREPLACE
RESOLVEREVISEROTAVATAROTFUNRSPSRSREFRSSRantanRegidRosetta
Rotptf_6DSAM-T08SAPISCA2STRUCTURESCALEITSEESFALLSGXPROSHAKESHAKE-N-BAKE
SHARPSHELXSHELX-90SHELX-96SHELX-97SHELX90SHELXDSHELXDESHELXESHELXL
SHELXL-92SHELXL-93SHELXL-96SHELXL-97SHELXTSIGMAASIR2002SOLOMONSOLVESOMORE
STARTINGSca2StructureShakeSingleStartingSuperflipTEXTALTFTFFCTNT/CCP4
TRANSFTRIVIALTRUNCATETSFGENULTIMAUNPUBLISHEDVARIOUSVECREFVECSUMVERIFY
WARPX-PLORX-PLOR/CNSX-sightX2DFXCALIBREXDSXFITXSIGHTXTAL
XTAL3.0XTALVIEWXpleoandautoautoBUSTERautoSHARPbp3ccp4:dphases
dynamiXilmodelmolmrbump/molrepmrxnotother jiffy programsphasingphenix/autosol
pirateqfitshakesirstartingstructureswiss-modelwarpntrace

2CMR

4kq3

2DX

4a82 4bpq

ABS

1rsg 3opc 4dim

ALMN

1aoj 1b4e 1cb6 1il2 1r4p 2bcc 3h1i

ALMN/CCP4

1a6u 1a7n 1a7o 1a7p 1a7q 1a7r

AMOLE

2d3e 2efs

AMoRE

1olp 4v4f 4v5t 4v5w 5gx9

APRV

3n5j 7qqv

ARP

1bte 1c7s 1c7t 1c9h 1d4t 1ddg 1eyv 1fd3 1iho 1irn 1iro 1jy3 1n8f 1qgw 1rc9 1tt6 1tz8 2aua 2ewc 3bqv 3brp 3dcl 3df7 3dmy 3e3x 3ewn 3eyt 3f5d 3fg9 3g5j 3gnj 3hcz 3hdj 3hmq 3i38 3i4p 3i8n 3ibz 3ic9 3ica 3ikb 3ilk 3iuj 3iul 3ius 3iv4 3ivp 3jrk 3jyf 3kbr 3kkb 3kyz 3kzd 3kze 3l1w 3lae 3lag 3lax 3laz 3ldu 3lhe 3lhh 3loq 3lsg 3lw9 3lzk 3m1r 3m33 3mah 3mn2 3mo4 3mt0 3mtr 3muq 3mw6 3mz1 3n04 3ne8 3neu 3nqr 3nyi 3nym 3nze 3o12 3o2i 3ocj 3ocm 3od1 3oi8 3olq 3om8 3on1 3on2 3oon 3ooo 3oop 3oos 3oou 3pmm 3pn8 3pnn 3qao 3qwt 3qz6 3r0v 3rob 3rpc 3rpw 3rq0 3rwp 3sc1 3sg0 3t8k 3tng 4du5 4e94 4hc5 4hde 4hku 4hn3 4hx6 4hyl 4i19 4i1d 4i6v 4ipt 4iyh 4j10 4jdu 4jpg 4jwo 4kt7 4ktb 4kv7 4kvf 4ljs 4llc 4m0g 4m0m 4m7o 4m9u 4nas 4neg 4noc 4npb 4nqr 4o5a 4p8r 4p9g 4ped 4pkl 4pkm 4plp 4pys 4pz0 4pzl 4q2b 4q31 4q6t 4q7o 4q7q 4qn8 4r0j 4r7q 4r82 4tqt 4tr3 4tx9 4tyz 4u12 4u2m 4u7j 4w1u 4wgj 4wi1 4wkw 4wky 4wny 4wok 4wsh 4wui 4wyq 4x84 4x8b 4xa9 4xea 4xed 4xel 4xfk 4xgi 4xgn 4xij 4xk1 4xkv 4xkw 4xl9 4xla 4xlc 4xle 4xlf 4xlh 4xm3 4xmy 4xn0 4xn3 4xnf 4xon 4xop 4xor 4xot 4xqf 4xr6 4y01 4yej 4yel 4yk1 4ymi 4yn1 4yn2 4yp3 4yqw 4yr0 4yr2 4yr3 4ywe 4ywj 4ywn 4z0t 4ziy 4zju 4zm3 4zoh 4zr8 4zyb 5ax6 5b8h 5bq2 5btw 5btz 5bu1 5bu2 5c50 5c6j 5c6l 5c8h 5cc8 5cqe 5dcf 5df6 5dgx 5dh0 5dh1 5dh2 5dle 5dml 5dmm 5dmn 5dwm 5dxd 5ebb 5ej2 5ek8 5eks 5enu 5eo6 5ewe 5ewf 5ewg 5eyu 5ez3 5ez4 5f2h 5f2k 5f2n 5f2o 5gwe 5h9m 5hal 5hdm 5hkf 5hki 5hm7 5hx0 5i3e 5i90 5j49 5j6b 5j6q 5j72 5jay 5k29 5kf0 5ncs 5ngl 5noa 5t5q 5u4s 5v77 5vix 5vn6 6ans 6anz 6aph 6aqb 6ar7 6b4a

ARP/wARP

1a48 1abo 1af7 1arp 1aru 1arv 1arw 1arx 1ary 1bqc 1bte 1c75 1cbg 1cec 1cen 1ceo 1chd 1clc 1ctn 1czf 1ddg 1dlw 1dup 1egp 1eu5 1euw 1exs 1ezv 1fc4 1fl0 1flp 1g87 1g8m 1ga1 1gad 1gae 1hzt 1i7q 1i9d 1ijq 1io0 1itx 1ixk 1ixl 1j6z 1ju4 1jzt 1jzw 1k6d 1k6f 1kjn 1ksg 1ksh 1ksj 1l9l 1lde 1ltm 1m24 1m32 1m7j 1mg7 1mkz 1mnh 1mni 1mnj 1mnk 1mo9 1mpx 1mtp 1mw5 1npy 1nr0 1nty 1nvj 1nz0 1o1z 1oxs 1p8c 1p9q 1pbt 1pbw 1pgv 1pnk 1pu5 1pv5 1pxv 1pzc 1q0r 1q0z 1qad 1qae 1qah 1qbb 1qgw 1qio 1qus 1r53 1r5l 1r61 1r7j 1rfe 1rgg 1rkq 1rrm 1rtt 1ru4 1rzn 1s8i 1sed 1sgw 1sjw 1sk1 1t6c 1t6d 1tht 1tn4 1tqh 1tt6 1txn 1tz8 1u5k 1u7h 1vjk 1vk1 1vk5 1vka 1vkc 1vkp 1vlq 1vm9 1wzb 1xfi 1xfj 1xkg 1xm8 1xmb 1xmt 1xq6 1xqa 1xrg 1xx7 1xyg 1xyz 1y81 1y82 1y9i 1y9q 1yav 1yb2 1yb3 1ybx 1yby 1ybz 1yga 1ygt 1yif 1ynb 1ynk 1yoc 1yqe 1yqh 1yt8 1yvi 1yxo 1yxy 1z72 1zki 1zma 1zs7 1ztp 1zx5 1zxu 2a13 2a3q 2a4k 2a9v 2ad1 2afq 2amx 2amy 2ark 2av4 2av9 2avd 2axq 2azp 2b14 2b15 2b16 2bdu 2be3 2be4 2bei 2chc 2ecr 2ed4 2esh 2exr 2f4w 2f96 2fb0 2fbn 2fck 2fdr 2fef 2fex 2fg1 2fk9 2fml 2fo3 2fpd 2ftp 2fu0 2fu2 2fzp 2g03 2g17 2g39 2g59 2g7u 2g84 2g8y 2gau 2gcu 2ge3 2gfq 2ghp 2gmq 2gmy 2gok 2gre 2gs5 2gs8 2gtq 2gts 2gu1 2gu2 2gup 2gux 2gwn 2gyq 2gz4 2h0u 2h16 2h17 2h6d 2h8o 2hay 2heh 2hei 2hhg 2hi1 2hiy 2hjs 2hlz 2hma 2hmc 2hn7 2hng 2ho4 2ho5 2hq6 2hr3 2hrz 2hs5 2hsj 2hyj 2i00 2i0m 2i1s 2i2o 2i52 2i5e 2i5u 2i6d 2i6x 2i71 2i79 2i7g 2i7h 2i7q 2i7r 2i8e 2i9c 2i9u 2i9x 2ia2 2iaf 2iai 2iaz 2ics 2id3 2idl 2ig7 2ig8 2igt 2ija 2ijc 2ijl 2ikb 2ikk 2il1 2il5 2in3 2j6v 2ja4 2jcd 2nac 2nad 2np3 2np5 2npn 2nqw 2nrk 2nx4 2nxo 2nzc 2o0m 2o0y 2o2a 2o30 2o35 2o52 2o5v 2o8n 2oa9 2oai 2obb 2ocb 2ocz 2od0 2odf 2odh 2odi 2oeb 2ofy 2og9 2ogj 2oiw 2ojh 2ols 2onr 2ons 2opj 2oux 2oy9 2ozv 2p06 2p0l 2p0o 2p12 2p3h 2p3p 2p4p 2p57 2p5i 2p9b 2paq 2pc6 2pd0 2pfr 2pfs 2pgs 2pgw 2pkh 2pli 2poz 2ppx 2psw 2pzz 2q05 2q07 2q24 2q6v 2qjc 2qm0 2qm3 2qmo 2qnu 2qrj 2qrk 2qrl 2qru 2qs8 2qsb 2qsi 2qvc 2qvg 2qx2 2qxy 2qyb 2qzj 2r48 2r4q 2r5f 2r8d 2r8r 2rbc 2rd7 2rdp 2rek 2rk0 2rk9 2tn4 2vma 2vmb 2w38 2yyg 2yyi 2yyj 2yyl 2yym 2zgi 3akc 3akd 3b49 3b73 3b79 3b85 3b8b 3bbl 3bcv 3be3 3bga 3bio 3bj6 3bm3 3bmx 3bor 3bp1 3bqy 3bro 3bs3 3bv8 3bwi 3byp 3bzw 3c0z 3c10 3c2b 3c4r 3c89 3c8a 3c8b 3c8z 3can 3cbn 3ced 3cex 3ci6 3cih 3cit 3ckk 3clk 3cni 3cnv 3co4 3co8 3cpg 3cuy 3cv3 3cxj 3cyg 3czp 3d0f 3d1p 3d3a 3d59 3d5l 3d8k 3dci 3ddh 3dew 3dli 3dlj 3dm8 3dns 3dwv 3dz8 3e0r 3e3v 3e4f 3eef 3eeg 3eer 3efg 3eh7 3ehe 3elk 3eoj 3eur 3euw 3exq 3f0a 3f3k 3f6a 3f6i 3f6q 3f6w 3fc3 3fcm 3fd3 3fdj 3ff4 3fgx 3fix 3fjy 3fn2 3fna 3fnc 3frz 3ftt 3fx3 3fzv 3g15 3g27 3g5j 3g7s 3gbv 3gdw 3gdz 3gjy 3gjz 3gkx 3gl5 3gmt 3gn3 3gox 3gpv 3grc 3gvx 3gyb 3gyk 3h1n 3h1q 3h35 3h36 3h4x 3h5t 3h75 3h9p 3ha9 3hb7 3hd5 3hdt 3he0 3heb 3hf7 3hfr 3hh0 3hh1 3hhh 3him 3hjv 3hl0 3hqx 3hrl 3hsi 3hv1 3i38 3i6c 3ic3 3ic6 3ic8 3icc 3id9 3idf 3ig2 3ih6 3iii 3ijm 3ilv 3ilx 3imi 3io1 3ipi 3iq1 3iqt 3iru 3is6 3isr 3isz 3itf 3iuk 3iuo 3iv3 3ivl 3iwf 3ix7 3jr2 3jtf 3ju3 3jw4 3k0b 3k13 3k17 3k28 3k2g 3k2v 3k6c 3k6r 3k85 3kao 3kcp 3kjx 3kmi 3knw 3kq5 3kwp 3kxr 3kzg 3kzl 3kzp 3l5z 3lay 3led 3leq 3lfr 3lft 3lg3 3lhf 3lhk 3lhl 3lk7 3lkl 3ll7 3llv 3lop 3lor 3lqk 3lqm 3lqy 3lso 3lto 3lup 3lv9 3lvu 3lwa 3lxq 3lyd 3m0z 3m1g 3m4r 3m6j 3m6y 3m92 3maj 3mbg 3mcz 3mfd 3mgl 3miz 3mkl 3mnf 3mqo 3mt1 3mti 3mtj 3mux 3mvk 3mvn 3mvp 3mxn 3mxq 3mzy 3n2q 3n3t 3n73 3n7z 3nbm 3ndh 3net 3nhm 3ni7 3o5v 3o66 3o6p 3obf 3oc4 3ocr 3ogh 3ohr 3oir 3oiz 3oj0 3olo 3omb 3omd 3on4 3op9 3oqg 3or3 3os6 3ot1 3ovk 3owc 3p01 3peb 3pes 3pf6 3pn9 3pp5 3pu9 3pzj 3qoc 3qom 3qoo 3qsj 3quf 3qvo 3r1x 3r2g 3r2q 3r31 3r3h 3r3t 3r4q 3r6d 3r7a 3r89 3rao 3rc3 3re2 3rhf 3rht 3rjt 3rmq 3rpd 3rpf 3rpj 3rqz 3rxz 3s52 3s9x 3sho 3shp 3sjr 3smd 3soy 3t61 3t6o 3t8q 3t9y 3te4 3teb 3tev 3tox 3tp9 3tpc 3ttg 3tx6 3tzt 3u0h 3u1d 3u1u 3u24 3u2r 3u4g 3u5r 3u7v 3udo 3udu 3ukj 3ulp 3ups 3urh 3us8 3uwd 3v0r 3v2g 3v48 3v4c 3v4d 3zmn 3zmo 4dci 4dim 4dkj 4dll 4dup 4e2g 4e4r 4eib 4ejo 4emy 4esj 4evq 4evr 4evs 4evu 4evx 4ew5 4ey3 4eyg 4eyk 4eyo 4eyq 4f06 4f3a 4f3s 4f8j 4fb4 4fb7 4fcc 4gak 4gb5 4gmv 4gn1 4gqa 4gud 4gym 4gyt 4h0c 4h3t 4h7l 4h7n 4h89 4hb7 4hbz 4hcj 4hd1 4hes 4hg2 4hvm 4hy3 4hyr 4i4k 4i66 4iag 4igv 4iq0 4iqn 4j2u 4jcu 4jfc 4jxq 4jxr 4kd6 4kpk 4kq9 4kvh 4kyw 4lk5 4lkb 4lmi 4lpq 4lqb 4lzk 4m1a 4m3s 4m7g 4mdy 4mi0 4mks 4mlz 4mo9 4moz 4mqd 4mtn 4mv2 4mve 4n2p 4neo 4np6 4o2i 4o9i 4oqj 4ot7 4pnc 4psu 4pva 4pwt 4pwz 4q29 4q88 4qb5 4qt6 4r1h 4r6h 4r6k 4r6y 4rha 4rjz 4rk0 4rk1 4rk2 4rk4 4rk5 4rk6 4rk7 4rk9 4rkq 4rkr 4rs3 4rsm 4ru1 4rxi 4rxl 4rxm 4rxt 4rxu 4rxv 4ry0 4ry1 4ry8 4ry9 4rya 5ig8 5nmu 5olp 5olq 5omt 5opj 5wjf 5yse 5zdm 5zdn 5zk4 5zmu 6abi 6abj 6ae9 6aig 6b91 6bea 6bhc 6c0d 6ccr 6chk 6cq7 6cum 6cw5 6d6j 6da0 6dqq 6dqr 6dqt 6dqu 6dtf 6dtg 6dth 6efw 6efx 6f3m 6f3n 6f3o 6f3p 6f3q 6f45 6fak 6fdd 6ff1 6fh1 6fpv 6g3b 6g62 6gfa 6ghs 6gvb 6gza 6hem 6hfz 6hmb 6hmc 6hmd 6hmq 6hpa 6hzf 6ie3 6iqo 6jl9 6kel 6m01 6mfu 6mg6 6mqh 6mtk 6mtz 6mye 6myf 6n1c 6n1f 6n39 6n56 6nab 6nb0 6ncs 6nq4 6od8 6oew 6ohz 6ojm 6okh 6ozd 6p81 6pzj 6q10 6qkg 6qkr 6qm2 6qpk 6qrr 6r64 6rhv 6rpp 6s48 6s4c 6s58 6s5w 6syj 6t21 6t22 6thf 6tjr 6tll 6tlo 6tlp 6tlr 6tlu 6tlv 6tlw 6u3l 6uk3 6ulo 6um4 6vw9 6w04 6wf6 6wf7 6wfh 6wfi 6wfm 6wgo 6wgy 6wi6 6wom 6wwd 6x7q 6x7r 6x7s 6xbq 6xbr 6xbs 6xbt 6xbv 6xn8 6yex 6yig 6yir 7ahs 7aov 7av6 7bny 7bq6 7btj 7bvi 7bys 7ckj 7cl2 7d18 7d1b 7k46 7kqa 7l4a 7l9u 7lkn 7lrh 7miw 7mx5 7nbv 7o44 7o51 7o53 7ouu 7q10 7qec 7qfi 7qgb 7qgc 7qgd 7qge 7qld 7rh8 7tbr 7uyg 7win 7zc9 7zcb 7zhf 7zj1 7zoh 8amo 8arl 8b3s 8bdw 8bvl 8c56 8c57 8c58 8c59 8d1u 8ebg 8fax 8hl9 8oun 8tv8

ASCALC

1c4d

AUTOMAR

5gqq

AUTOMR

1a4f 1bgi

AVGSYS

1agr

Accelrys

2b7d

Agrovata

1eym

Auto

3hsw 3o4m 4m3c

AutoBuild

3owv 4ggp 4ike

AutoSol

5egf 5k04 5x6a

BALBES

5dqx 5vkd

BASED

1qhj

BAZFAZ

1rmd

BEAST

1l4a 1lqt 1n5z 1nr4 1rj2 1x6j 1xqs 1xrh 1y9r 1ya3 1zbb 2abi

BIOMOL

1a47 1cqi 1cqj 1r4q

BLANC

1m38 1mor 1obr

BP3

3erw 3eu3 3gh9 3gha 4hgy

BRICOGNE

2vsg

BRICOGNE'S

1a34

BRUTE

1dm0 1f4u 1fyu 1kfi 1l5t 1ucb 1ukr 1y0g 2bos 2zg2 481d

BUCCANEER

3imi 3n8h 3ni7 3nkh 3nkl 3ntx 3onq 3op1 3os4 3ouz 3pei 3qok 3qtt 3r5x 3r7t 3rj4 3rju 3rnl 3rnr 3rq1 3s7z 3sql 3sqm 3to3 3tu3 3un6 3uxv 3uy4 3zrv 3zrx 4bf9 4dim 4eru 4gbj 4gyt 4h3v 4h7l 4i66 4ir0 4jsb 4jvt 4kd5 4mx8 4njc 4ql6 4rpf 5f0k 5f91 5f92 5far 5fb3 5fda 5hi6 5ig8 5il0 5jvb 5jvn 5k29 5k3j 5kh1 5l9w 5lo9 5lq5 5lu4 5lui 5luj 5luk 5lul 5mh0 5mtz 5n1c 5nm8 5noa 5ogb 5olp 5olq 5omt 5opj 5osa 5tf2 5tjj 5udf 5v8k 5ve2 5vg2 5wjf 5xav 5y89 5z06 5z1z 5z20 5z21 5z3r 6a9s 6c29 6ckn 6cwx 6cz6 6da0 6dq3 6efw 6efx 6ejs 6f9p 6ff1 6fie 6flo 6fpp 6g9x 6ghc 6ghs 6goc 6gxv 6gya 6h2x 6h4g 6h7x 6hlk 6hzf 6i59 6i5c 6imu 6inr 6k2x 6lhx 6mbx 6n1c 6n56 6nyp 6oew 6ohz 6om4 6om5 6pqh 6q26 6q4s 6q63 6q9m 6qm2 6rhv 6s7x 6s7y 6t2n 6t2r 6tj0 6to1 6tx0 6um4 6ut3 6v8j 6vkf 6vw9 6x44 6xi1 6zpj 6zpk 6zpm 7b0o 7b2a 7b2d 7b5j 7bbm 7cn6 7dih 7el2 7jqe 7k3n 7kpj 7l9r 7lbk 7lcz 7ldk 7lha 7ljp 7m7a 7n1l 7nmu 7o23 7o44 7ofw 7poa 7pob 7poc 7qe3 7qih 7qw5 7r55 7rgr 7roa 7s5o 7u4q 7xq5 7ycs 7ycu 7z3m 7z7e 8ah3 8avk 8avm 8avn 8b3e 8b3s 8c46 8d5e 8d5j 8d5k 8en9 8ena 8fhu 8fvx 8grt 8gxr 8hfp 8ic8 8if2 8ing 8kg3 8oxv 8u1j 8wy1

BUSTER-TNT

2vj2

Bacillus

3m5y

CCP$

4e5s 4lpq

CCP4

19hc 1a02 1a0p 1a54 1a55 1a73 1a79 1a7u 1a88 1a8i 1a8q 1a8s 1a8u 1a8v 1ae8 1af6 1afe 1ah7 1ahu 1ahv 1ahz 1aj6 1an8 1aq1 1ar0 1ask 1avn 1b01 1b05 1b08 1b0d 1b0n 1b0z 1b12 1b14 1b15 1b16 1b2l 1b32 1b37 1b3f 1b3g 1b3j 1b3l 1b40 1b46 1b4d 1b4z 1b51 1b52 1b58 1b5e 1b5i 1b5j 1b5q 1b65 1b68 1b6c 1b92 1b9j 1bb6 1bb7 1bbu 1bbw 1bd8 1bdx 1be3 1bg6 1bh3 1bj4 1bkc 1bl8 1blf 1bqs 1bro 1bs2 1bue 1bv3 1bx3 1bxe 1by2 1byg 1byl 1byr 1bys 1byw 1bz4 1c10 1c4f 1c4x 1c6v 1c8m 1cc0 1cc2 1ccw 1cdz 1cf9 1cgk 1cgz 1chw 1civ 1cjs 1ckp 1cml 1cmx 1cp7 1cqe 1cv8 1d0b 1d6f 1d6h 1d6i 1dak 1ddk 1dfg 1dfh 1dfi 1dg3 1diw 1dji 1djy 1dll 1dmr 1ebf 1ebo 1ecr 1efc 1efr 1ej6 1em0 1ema 1eqz 1fnh 1fnt 1fok 1fr1 1fr6 1ftq 1ftw 1fty 1fu4 1fu7 1fu8 1g3m 1g63 1g8f 1g8g 1g8h 1gg8 1gg9 1gge 1ggf 1ggh 1ggj 1ggk 1ggn 1gh7 1gnm 1gnn 1gno 1grn 1gzi 1hlf 1hlg 1hm6 1hqv 1i5e 1igw 1ijq 1ipp 1ixv 1j53 1j54 1j5s 1j5t 1j5u 1j5x 1j6o 1j6p 1j6u 1j9y 1jc9 1jet 1jeu 1jff 1jfm 1jgo 1jgp 1jgq 1jky 1jof 1jzt 1k0o 1kac 1kas 1kbo 1khh 1kjt 1kkp 1kl1 1knv 1ko0 1ksf 1ksi 1kz8 1l0l 1l0n 1l3p 1lj7 1lp3 1lz8 1lz9 1m1f 1m68 1m6c 1m6m 1mdn 1mgt 1mj2 1mjl 1mjp 1mk7 1mk9 1mno 1moq 1mos 1mug 1mwc 1mwd 1mwp 1n05 1nbm 1ned 1njm 1njo 1njp 1np4 1ntv 1nu8 1o0w 1o0x 1o12 1ond 1or2 1or3 1p0k 1p53 1p9x 1pjb 1pjc 1po5 1prg 1q46 1qaf 1qak 1qdm 1qex 1qf6 1qf7 1qfm 1qfs 1qfx 1qg3 1qgt 1qhl 1qsd 1rep 1rgp 1rjw 1ru4 1s2e 1say 1sj5 1spp 1spu 1tf6 1tgo 1tjn 1tl2 1ttr 1tw7 1u79 1uf2 1vao 1vcb 1ve9 1ves 1vfe 1vsr 1wra 1wwc 1x38 1x39 1x8g 1x8h 1x8i 1xbr 1xw5 1xw6 1xwk 1y0o 1ykc 1ylv 1zfj 1znj 2a3h 2aar 2ab6 2akc 2bmi 2cns 2coq 2cpg 2d2z 2d6b 2dmr 2eif 2eul 2f3m 2f6s 2f96 2ffh 2fl1 2fm6 2fpd 2fu6 2fu7 2fu8 2fu9 2gfj 2gfk 2gkl 2gpn 2h6a 2h7q 2h7s 2h9w 2hap 2hb9 2hq1 2hr5 2hrv 2ia0 2ikq 2ipb 2nap 2nsy 2o9x 2ogs 2ogt 2pc6 2ppo 2ppp 2prn 2pz9 2q8v 2qds 2qdt 2rbi 2thi 2vao 357d 3a3h 3c7i 3cni 3d59 3dmr 3ea4 3eer 3efd 3ela 3elk 3et0 3et1 3et2 3et3 3ewp 3ewr 3exn 3f0a 3f6w 3f81 3fdi 3fh3 3fkt 3fru 3fsg 3ftt 3fzv 3g0m 3g1l 3g5j 3g5m 3g7f 3gam 3gjz 3gsb 3gyg 3hfr 3hw7 3i38 3i77 3ibz 3icc 3iii 3jq4 3jqw 3jqx 3jus 3juv 3k0b 3k8t 3kgf 3knw 3krr 3kxr 3kzy 3kzz 3l00 3l18 3lay 3ld6 3lf0 3lkl 3lm9 3lmy 3lqu 3lqy 3lrj 3ls6 3lsh 3lsi 3lsk 3lsm 3m6y 3mah 3mbg 3mg5 3mk3 3mnh 3mni 3mnj 3mnk 3mp3 3mp4 3mqt 3mwm 3n7k 3n7l 3n7m 3nfr 3nq4 3nqr 3nth 3nud 3nue 3o8g 3o8h 3oc0 3oet 3ohr 3ok8 3oow 3op3 3opk 3opq 3orx 3orz 3os6 3ot1 3otu 3our 3out 3oxp 3oz3 3oz4 3p0r 3p4b 3p4d 3p4w 3p50 3p52 3pb1 3pj9 3prn 3pu9 3pyz 3q3v 3q61 3qqt 3qsl 3qtd 3qwg 3qyx 3rao 3re2 3sd8 3sh1 3sio 3smh 3t4m 3t69 3t9p 3tdi 3tdu 3tdz 3tfo 3tnz 3to0 3tox 3tpc 3txv 3udo 3udu 3uhj 3ukb 3ukc 3uke 3uwd 3v06 3v07 3v0r 3v2g 3v48 3v4c 3v4d 3vhb 3w7y 3w7z 3w80 3wlj 3wtr 3wvm 3x2y 3x2z 434d 467d 4a3h 4aed 4dbz 4dc0 4dc1 4dhj 4dhz 4dmr 4dnz 4do1 4dpo 4dqx 4dvj 4dyv 4e1j 4e2i 4egn 4ego 4egp 4f2y 4f3s 4fvc 4fzh 4gfg 4gkl 4gl5 4gl7 4gmx 4gpt 4gqp 4h1d 4h65 4h67 4h6d 4h7b 4hqh 4i5q 4i65 4id6 4ien 4igv 4ij9 4ilf 4ipi 4ipj 4iul 4iuy 4j2o 4jhy 4jrk 4jrw 4juv 4k14 4k8i 4k8j 4kju 4kjv 4kky 4kso 4l67 4l68 4l6q 4ldk 4lmz 4lsy 4ltt 4lua 4lur 4m20 4m2a 4m2b 4m85 4mak 4mbu 4mi1 4mjx 4mri 4mxu 4mzm 4mzp 4mzt 4n7q 4ncp 4nfr 4nkr 4nzm 4nzn 4nzo 4o33 4o3f 4o4b 4o4c 4o4d 4o4e 4o4f 4o9f 4o9i 4o9l 4oa7 4onc 4ont 4onw 4op4 4oqj 4osh 4pop 4pov 4ppz 4pq1 4pqa 4psu 4pu2 4pv6 4pva 4pvb 4pvi 4pw4 4pwn 4q4c 4q4d 4qb4 4qf5 4qhp 4qir 4qme 4qpe 4qpt 4quo 4reu 4rxi 4rxv 4thn 4v42 4vhb 5a3h 5aec 5gds 5msf 5prn 6a3h 6msf 6prn 7a3h 7msf 7prn 8a3h 8prn

CCP4/O

1hvu

CCP4:

1idq 1idu

CCP4I

2izw

CHAIN

1anf 3mbp 4mbp

CHAINSAW

4dkj

CNS

1un6 2vf9 4v51 4v5c 4v5d 4v5e 4v5g 4v5j 4v5l 4v5o 4v5p 4v5q 4v5r 4v5s 4v8n 4v8o 4v8x

COMPLEX

1i8t

COO

4hvm

CROQUE

1sk5

CRUNCH2

3k44

CaspR

2yxt 2yxu 4lho 4lhp 4ryi

Coot

1vs1 1xv2 1y89 1ylx 1yxy 1z6m 1z72 1z77 1zs7 1zwy 1zx5 2aee 2ahr 2ark 2au5 2av9 2bdd 2be3 2dg2 2f06 2f4z 2f6s 2f96 2fbn 2fdo 2fdr 2fef 2fex 2ffc 2fg1 2fgc 2fo3 2fu0 2fue 2fyw 2g03 2g17 2g3a 2g3b 2g7u 2g7z 2g8y 2g9i 2gau 2gfn 2gfq 2ghi 2gs8 2gtq 2guu 2gwn 2h5n 2h6x 2h6y 2h6z 2h70 2h71 2h72 2h73 2h74 2h75 2h76 2hi1 2hiy 2hjs 2hr3 2hsj 2hsn 2i6d 2i6x 2i7g 2i7h 2i8e 2i9c 2ia2 2iaf 2iai 2id3 2id6 2idl 2if7 2ig7 2igt 2ijl 2il1 2in3 2np3 2np5 2npm 2npn 2nqw 2nrk 2nzc 2nzt 2o0y 2o1z 2o35 2o4u 2o52 2o5u 2o8n 2o8p 2o9x 2oai 2obb 2ocb 2ocz 2oeu 2ofy 2oiw 2ojh 2ozv 2p0o 2p3h 2p3p 2p4p 2p57 2pc6 2pd0 2pfr 2pfs 2pli 2ppx 2pz9 2q24 2qm0 2qm3 2qmo 2qnu 2qru 2qsb 2qsi 2qx2 2qyb 2r48 2r4q 2r5f 2r8d 2rbc 2rd7 2rdp 2v6h 3as8 3asd 3asf 3asg 3ash 3aub 3auc 3b6a 3b6c 3b85 3b8b 3bfx 3bgg 3bgj 3bio 3bk0 3bor 3bqy 3bs3 3bv8 3bvd 3bvj 3c7j 3can 3cdh 3cdk 3ced 3cex 3ci6 3cit 3ck2 3ckk 3cni 3cp0 3czp 3d0f 3d0j 3d0k 3d1p 3d3r 3d3s 3d6s 3dax 3dbp 3dca 3dci 3dcl 3ddh 3dew 3dm8 3dns 3dwd 3dx5 3dz8 3e0r 3e3x 3e4f 3e7n 3e9q 3ea0 3eap 3ec6 3ec7 3ect 3eer 3efb 3efg 3egl 3eh7 3ehe 3ejb 3ejd 3eje 3elk 3eur 3ewl 3exn 3eyt 3f0a 3f0b 3f0c 3f0q 3f0s 3f0u 3f0v 3f0x 3f2r 3f3k 3f3y 3f42 3f5v 3f67 3f6m 3f6o 3f6v 3f9u 3fd3 3fdi 3fdj 3fed 3fes 3fet 3feu 3fg8 3fgg 3fgx 3fh0 3fh3 3fie 3fii 3fix 3fm0 3fm5 3fn2 3fna 3fnb 3fnc 3fpi 3fq0 3fqf 3fqo 3fqv 3fqz 3fsg 3ftt 3fvy 3fwz 3fx3 3fz5 3fzv 3g15 3g27 3g2g 3g3d 3g3m 3g5j 3g64 3g9x 3gdw 3gdz 3gf9 3ghd 3gjz 3gkx 3gl5 3gn3 3gr4 3gv4 3gyg 3h1q 3h35 3h36 3h6m 3h9p 3ha9 3hb7 3hbc 3hdt 3he0 3hf7 3hfr 3hh1 3hhh 3hhl 3him 3hl0 3hlu 3hm2 3hmj 3hnw 3hqx 3hrl 3hsi 3htr 3hyq 3i38 3i4p 3i8a 3ib3 3ibz 3ic3 3ic6 3ic7 3ic8 3icc 3idf 3ig2 3ih2 3ih3 3ih4 3ih5 3ih6 3iii 3ijm 3ijw 3ilx 3iq1 3iqt 3iru 3is6 3isr 3ist 3isu 3isv 3isz 3iuk 3iuo 3iv3 3iv6 3ivl 3iwf 3ix7 3jr2 3jtf 3ju1 3ju3 3ju8 3jw4 3jzy 3k0b 3k0l 3k13 3k2v 3k5k 3k6c 3kao 3kd9 3kdr 3kkw 3kmi 3kwp 3kxr 3kzl 3kzp 3l0z 3l5z 3lay 3led 3leq 3lfr 3lft 3lg4 3lhf 3lhk 3lk7 3lkb 3lkl 3ll7 3llv 3lnl 3loc 3lor 3lqk 3lqy 3lso 3lup 3luq 3lus 3lv9 3lvt 3lvu 3lwa 3lxq 3lyd 3m0f 3m0z 3m1a 3m1g 3m4r 3m6j 3m6l 3m7i 3m92 3m9c 3mah 3maj 3mav 3mcz 3mfd 3mgl 3mi2 3mkl 3mle 3mnf 3mo7 3mqo 3mqt 3mt1 3mti 3mtj 3mux 3mvk 3mvn 3mvp 3mw7 3mwa 3mwb 3mxq 3my7 3myf 3mzy 3n2m 3n2q 3n34 3n3m 3n3t 3n70 3n73 3n7z 3n99 3nbm 3net 3nhm 3ni7 3niw 3nqr 3o2n 3o5v 3o5y 3o60 3o66 3o6p 3obf 3ocr 3oir 3oiz 3oj0 3olo 3omb 3omd 3on4 3op4 3op9 3opc 3os6 3owc 3p01 3p7j 3peb 3pf6 3pgg 3pgp 3phd 3pkj 3poz 3pzw 3qdk 3qir 3qom 3qoo 3qsj 3qsl 3qtb 3qtd 3quf 3qvo 3qwp 3qxc 3qxh 3qxj 3qxs 3qxx 3qy0 3r1x 3r6d 3r7a 3r89 3r90 3rao 3ray 3rbn 3rco 3re2 3rht 3rjt 3rmq 3rpd 3rpj 3rq4 3rqr 3rqz 3rro 3rsh 3rvt 3rvu 3rvv 3rvw 3rvx 3s3i 3s7e 3s7i 3sgy 3sh2 3sho 3shp 3sjr 3sks 3slb 3slf 3smq 3smt 3snm 3soy 3t66 3t69 3t6o 3t8q 3t9y 3teb 3tev 3tfo 3tj0 3tl2 3tnj 3tox 3tp9 3tpc 3tpf 3ttg 3tug 3tx6 3txv 3u0h 3u1d 3u1u 3u24 3u2r 3u3x 3u4g 3u5r 3u7v 3udo 3udu 3uec 3ued 3uee 3uef 3ueg 3ueh 3uei 3ukj 3ulp 3ups 3ur4 3v08 3v09 3v0r 3v2g 3v4c 3v4e 3wpw 3wpx 3zc1 4bej 4dci 4dim 4dll 4dpo 4dqx 4du5 4dvj 4dyv 4e1j 4e2g 4e47 4emy 4ep1 4euy 4evq 4evr 4evs 4evu 4evx 4ewq 4ey3 4eyg 4eyk 4eyo 4eyq 4f06 4f3s 4f8j 4fb4 4fb7 4fmu 4fmw 4g2p 4gak 4gb5 4gbj 4glp 4gqa 4gqp 4gym 4gyt 4h0c 4h31 4h3t 4h3v 4h7l 4h7n 4h89 4hb7 4hbz 4hd1 4heb 4hes 4hg2 4hsg 4htv 4i51 4i66 4ia9 4iag 4iim 4iio 4ijd 4ink 4inl 4iq0 4iqd 4iqg 4iqn 4iw7 4j2u 4jcu 4jds 4jfc 4jfr 4jhc 4jhs 4jqo 4jsb 4jxq 4jxr 4k1s 4k1t 4k7z 4kd6 4kjm 4klv 4klw 4klz 4kor 4kos 4kot 4kou 4kov 4kow 4kox 4koy 4kpk 4kua 4kub 4kvh 4kwt 4l6q 4l8a 4lk5 4lkb 4lmi 4lqb 4m1a 4mdy 4mjd 4mlz 4mo3 4moz 4mqd 4mtn 4mv2 4mve 4mvt 4my0 4my3 4neo 4nf2 4nnq 4o2i 4o2w 4oad 4oae 4ofw 4ogf 4ogg 4omf 4oq8 4oq9 4orx 4os0 4os3 4os8 4p0t 4p3w 4p4m 4p5p 4p5t 4p6v 4p6z 4p71 4p72 4p73 4p74 4p75 4p7l 4p7n 4p7o 4p7q 4p7r 4p7w 4p7x 4p9i 4p9t 4p9w 4p9x 4p9y 4pb0 4pb6 4pb9 4pc8 4pcg 4pch 4pco 4pcv 4pd4 4pdj 4pdq 4pdw 4pe2 4pe8 4peu 4pfh 4pfo 4pfp 4pg0 4pg1 4pg4 4pg5 4pg6 4pg7 4pg8 4pgd 4pge 4pgi 4pgk 4pgl 4pgo 4ph9 4phu 4pii 4pim 4pj3 4pjj 4pjk 4pjl 4pjm 4pjn 4pjo 4pjr 4pjs 4pk4 4pkg 4pkh 4pki 4pkl 4pkm 4pl7 4pl8 4plc 4pld 4pln 4plo 4plt 4pm1 4pme 4pmf 4pmi 4pmj 4pn7 4pnc 4poz 4pp1 4pp2 4pwo 4pwp 4pyz 4q29 4q63 4q6w 4q7a 4qgn 4ql1 4qlj 4qlk 4qll 4qpp 4qqe 4qqk 4qqn 4qt6 4r5q 4rg1 4rg2 4rha 4rr5 4ryl 4tkn 4tkx 4tky 4tlj 4tmd 4tmf 4tn8 4tnn 4tno 4tnv 4tnw 4to9 4toa 4tob 4toc 4tod 4toe 4tof 4tog 4toh 4toq 4toy 4tph 4tpl 4tq8 4tqh 4tqi 4tqp 4tqq 4tqs 4tr3 4trt 4ts6 4ts8 4tsd 4tsf 4tsm 4tt3 4ttb 4ttc 4ttw 4ttx 4tty 4ttz 4tu1 4tuh 4tuj 4tuk 4tul 4tuo 4tvf 4tvi 4tvq 4tw2 4twe 4twn 4two 4twp 4twt 4tx9 4txk 4txo 4ty6 4ty7 4tyf 4tym 4tyt 4tz2 4tz4 4tz8 4tz9 4tza 4tzb 4tze 4tzf 4tzg 4tzi 4tzk 4tzt 4u07 4u0g 4u0h 4u0j 4u0k 4u0o 4u0s 4u12 4u13 4u1r 4u1t 4u2h 4u2i 4u2j 4u4e 4u4h 4u4s 4u4x 4u5a 4u5z 4u60 4u61 4u62 4u68 4u6u 4u7t 4u7u 4u7w 4u89 4u8m 4u8n 4u8o 4u8p 4u8t 4u97 4u9a 4u9o 4u9p 4u9q 4u9s 4u9u 4uam 4ubq 4v5a 4w4g 4w4m 4w4t 4w4u 4w4z 4w50 4w51 4w52 4w53 4w54 4w55 4w56 4w57 4w58 4w59 4w5k 4w5v 4w66 4w6w 4w6x 4w6y 4w9a 4w9b 4w9z 4wa0 4wa6 4wac 4wad 4waj 4wak 4wam 4wbi 4wbl 4wbx 4wc9 4wca 4wcb 4wcc 4wd6 4wd9 4wda 4wdb 4wdd 4wde 4wdf 4wdg 4wdh 4wdq 4wdr 4wdy 4wdz 4we0 4wec 4wee 4wej 4wek 4wel 4wer 4wet 4wev 4wex 4wey 4wf4 4wf5 4wfd 4wfr 4wfu 4wfv 4wg0 4wgv 4wgx 4wha 4whb 4whe 4whf 4whg 4wih 4wis 4wit 4wjn 4wjo 4wjp 4wjq 4wk1 4wk3 4wkj 4wky 4wl0 4wml 4wn3 4wn4 4wnc 4wnd 4wne 4wnf 4wng 4wni 4wnx 4woj 4wok 4wpg 4wq2 4wq3 4wq7 4wq8 4wq9 4wqa 4wqb 4wqc 4wqd 4wqe 4wqk 4wql 4wqs 4wqt 4wr4 4wr5 4wsi 4wth 4wtp 4wtq 4wtr 4wts 4wtv 4wui 4wuj 4wuo 4wup 4wuq 4wv3 4wv4 4wv6 4wva 4wvb 4wvc 4wvd 4wvm 4wvv 4ww6 4ww8 4wxx 4wy2 4wy3 4wy7 4wy8 4wyb 4wyk 4wyq 4wyy 4wz0 4wz2 4wz3 4wz4 4wz5 4wz7 4x08 4x09 4x0w 4x0y 4x0z 4x10 4x11 4x12 4x13 4x14 4x15 4x16 4x17 4x1l 4x1m 4x1n 4x1r 4x1s 4x1u 4x25 4x30 4x42 4x43 4x47 4x49 4x4a 4x4j 4x4k 4x51 4x5u 4x6a 4x6k 4x6z 4x7v 4x80 4x84 4x8b 4x8d 4x8e 4x8w 4x90 4x91 4x92 4x93 4x94 4x95 4x97 4x9m 4x9n 4x9r 4x9v 4x9w 4xa8 4xa9 4xah 4xai 4xaj 4xak 4xap 4xb9 4xba 4xbf 4xbh 4xbt 4xbv 4xbw 4xbx 4xby 4xc4 4xc6 4xc7 4xc8 4xct 4xcv 4xcw 4xdg 4xdh 4xdv 4xdw 4xdx 4xe0 4xe5 4xei 4xel 4xf2 4xfj 4xfk 4xg1 4xgi 4xgl 4xgm 4xgn 4xgu 4xh1 4xh4 4xh5 4xh6 4xhm 4xi1 4xi6 4xi7 4xib 4xic 4xid 4xih 4xk2 4xkn 4xkp 4xkq 4xkr 4xkv 4xkw 4xl9 4xla 4xlc 4xle 4xlf 4xlh 4xli 4xlt 4xm3 4xmy 4xn0 4xn3 4xnf 4xnr 4xon 4xop 4xor 4xot 4xpb 4xpf 4xpg 4xpt 4xpz 4xq7 4xqf 4xr6 4xrw 4xs5 4xs7 4xs9 4xsa 4xsb 4xsj 4xst 4xt0 4xtb 4xtk 4xtp 4xtr 4xuv 4xux 4xuy 4xuz 4xvh 4xvu 4xw3 4xwo 4xwt 4xww 4xwy 4xx6 4xx9 4xxd 4xyn 4xyp 4xyx 4xz9 4xzq 4y0d 4y0g 4y0h 4y0i 4y0j 4y0l 4y0v 4y0x 4y12 4y1c 4y1d 4y1k 4y25 4y33 4y35 4y36 4y37 4y38 4y39 4y3a 4y3d 4y3e 4y3f 4y3h 4y3j 4y3l 4y3m 4y3n 4y3o 4y3p 4y3q 4y3r 4y3s 4y3t 4y3w 4y3x 4y3y 4y3z 4y41 4y43 4y44 4y45 4y47 4y48 4y4a 4y4b 4y4d 4y4e 4y4f 4y4g 4y4h 4y4j 4y4k 4y4o 4y4p 4y4r 4y4t 4y4u 4y4w 4y4x 4y4z 4y50 4y51 4y52 4y53 4y54 4y56 4y57 4y58 4y5a 4y5b 4y5c 4y5e 4y5g 4y5j 4y5k 4y5l 4y5m 4y5n 4y5o 4y5p 4y60 4y6c 4y6n 4y6u 4y6w 4y7f 4y7g 4y7n 4y9j 4y9l 4y9v 4y9x 4ybg 4yck 4ycr 4yct 4ycx 4ycy 4yd1 4yd2 4yd3 4yd4 4yd5 4yd6 4yd7 4ydu 4ydx 4ye2 4ye8 4yea 4yec 4yee 4yef 4yeh 4yej 4yel 4yem 4yen 4yeo 4yeu 4yfj 4yfk 4yfn 4yfu 4yfx 4yg2 4ygf 4ygo 4yha 4yhb 4yhh 4yhr 4yhx 4yis 4yit 4yiv 4yiz 4yk8 4yk9 4yke 4ykn 4yl0 4yl1 4yl3 4yld 4ylg 4yly 4yma 4ymb 4ymc 4ymg 4ymh 4ymi 4ymk 4ymp 4ymy 4yn1 4yn2 4yn8 4yng 4ynq 4ynw 4yo2 4yof 4yoz 4yp3 4ypm 4ypq 4yqe 4yqw 4yr0 4yr2 4yr3 4yrh 4ys4 4ys9 4ysb 4ysk 4ysl 4ysn 4ysv 4yu0 4yu5 4yu6 4yvg 4yvh 4yvi 4yvj 4yvk 4ywj 4ywn 4ywo 4ywp 4ywr 4yx6 4yxf 4yxt 4yxw 4yy0 4yy1 4yy2 4yy5 4yy7 4yy9 4yya 4yyb 4yyc 4yyp 4yyx 4yzd 4yzf 4yzr 4yzs 4yzy 4z04 4z09 4z0d 4z0e 4z0f 4z0i 4z0o 4z0r 4z1f 4z1g 4z1h 4z1i 4z1m 4z1o 4z1x 4z1z 4z20 4z21 4z2g 4z2h 4z2i 4z2j 4z2k 4z2l 4z3a 4z3b 4z3l 4z3s 4z3u 4z3w 4z3x 4z3z 4z50 4z79 4z80 4z81 4z8c 4z8e 4z8g 4z8l 4z8n 4z94 4z96 4z97 4z98 4z9l 4z9r 4z9v 4za0 4zae 4zc4 4zc7 4zch 4zci 4zck 4zcl 4zcm 4zcp 4zcq 4zcr 4zcs 4zcw 4zdh 4ze6 4zea 4zf3 4zf4 4zf5 4zf6 4zf8 4zfa 4zfb 4zg0 4zge 4zgj 4zgw 4zh1 4zhl 4zhm 4zhn 4ziq 4ziu 4ziy 4zj7 4zjg 4zjh 4zjr 4zju 4zjw 4zkn 4zko 4zkr 4zks 4zl1 4zla 4zle 4zlf 4zlg 4zli 4zm1 4zm3 4zm4 4zm5 4zm6 4zmi 4zmk 4zmr 4zms 4zng 4znn 4zoh 4zop 4zot 4zou 4zp4 4zph 4zqb 4zqd 4zr8 4zrl 4zrm 4zrn 4zs4 4zsc 4zsd 4zse 4zsf 4zt2 4zt3 4zt4 4zt5 4zt6 4zt7 4zt8 4zto 4zu0 4zux 4zv8 4zwr 4zws 4zxe 4zxo 4zxs 4zxv 4zy7 4zy9 4zyj 4zyk 4zym 4zyp 4zyt 4zyu 4zyv 4zyw 4zyx 4zyy 4zyz 4zz0 4zz1 4zz2 4zz3 4zz4 4zz5 4zz6 4zz8 5aui 5auk 5auz 5av0 5av1 5av2 5av3 5av4 5awf 5awg 5ax7 5axf 5axi 5ay8 5ay9 5ayf 5ayh 5ayp 5az3 5azd 5aze 5azf 5azg 5azh 5azq 5azr 5b1q 5b1r 5b1y 5b21 5b26 5b2a 5b2h 5b3t 5b3u 5b3v 5b43 5b4k 5b4l 5b73 5b75 5b76 5b77 5b78 5b79 5b7g 5b7n 5b7p 5b7q 5b7z 5b80 5bjs 5bmu 5bmz 5bn2 5bn8 5bn9 5bnv 5bnw 5bnx 5bnz 5bo0 5boh 5box 5bp3 5bpb 5bpd 5bpi 5bpl 5bpm 5bpn 5bpp 5bpq 5bpu 5bq2 5bq8 5bq9 5bqb 5bqc 5bqe 5bqf 5bqo 5bqp 5bqt 5br9 5bro 5brp 5bs7 5bs8 5bta 5btc 5btd 5btf 5btg 5bti 5btl 5btn 5bts 5btu 5btw 5btx 5bu0 5bu1 5bu2 5bu3 5bu6 5bu9 5bum 5buo 5bup 5buq 5bvg 5bvh 5bvs 5bvt 5bw8 5bw9 5bwj 5bwk 5bwr 5bwt 5bwu 5bwv 5bww 5bwx 5bx6 5bx7 5bx9 5bxa 5bxo 5bxu 5bxv 5bxy 5by2 5byl 5c04 5c05 5c0m 5c0r 5c0s 5c0v 5c0w 5c0x 5c0y 5c16 5c1d 5c1g 5c1h 5c2f 5c36 5c38 5c3a 5c3b 5c3d 5c3u 5c3x 5c47 5c48 5c49 5c4b 5c4c 5c4d 5c4e 5c4f 5c4k 5c4l 5c4y 5c50 5c5e 5c5n 5c69 5c6b 5c6d 5c70 5c71 5c7g 5c7p 5c85 5c8a 5c8d 5c8e 5c8f 5c8h 5c8o 5c8p 5c8q 5c8r 5c9c 5c9j 5ca3 5cad 5cae 5cb0 5cb2 5cb3 5cb5 5cbf 5cbh 5cbk 5cbr 5cbs 5cc2 5cc4 5cc8 5ccd 5cce 5ccf 5ccv 5cdl 5cdv 5ce6 5cef 5cfj 5cfy 5cg0 5cgk 5ch6 5chh 5chn 5cht 5chv 5chw 5cik 5cje 5cjt 5cju 5cjv 5cjw 5ck7 5ckr 5cl3 5cl4 5cl5 5cl6 5cl7 5cl8 5cl9 5cla 5clb 5clc 5cld 5cle 5clx 5cly 5clz 5cm1 5cm7 5cmn 5cmp 5cmq 5cmr 5cms 5cmw 5cmy 5cn1 5cn2 5cn3 5cnh 5cns 5cnt 5cnu 5cnv 5cnx 5cod 5cow 5cqe 5cr3 5crd 5cre 5crg 5crh 5cs0 5cs4 5csa 5csd 5csk 5csl 5cso 5cst 5ctm 5ctn 5cu1 5cv1 5cv3 5cv8 5cvc 5cvy 5cwb 5cwc 5cwd 5cwe 5cwf 5cwg 5cwh 5cwi 5cwj 5cwl 5cwm 5cwn 5cwo 5cwp 5cwq 5cx1 5cx8 5cxa 5cxd 5cxf 5cy1 5cya 5cyu 5cyv 5czc 5czd 5czj 5czm 5d00 5d01 5d0r 5d18 5d1q 5d1w 5d27 5d2b 5d2l 5d2m 5d39 5d3c 5d3q 5d3v 5d3w 5d3x 5d3y 5d43 5d4k 5d5k 5d5l 5d5n 5d61 5d62 5d63 5d6n 5d80 5d81 5d82 5d83 5d8n 5d90 5d94 5d9e 5d9m 5d9n 5d9o 5d9p 5d9s 5d9u 5d9y 5da3 5da6 5da9 5dac 5dag 5dau 5dbq 5dbt 5dbu 5dco 5dcr 5dcs 5dd7 5ddg 5ddh 5de8 5dea 5deh 5den 5dg5 5dgm 5dgx 5dh3 5dh9 5dha 5dhf 5di9 5dib 5dj7 5dj9 5dje 5djq 5dk1 5dk5 5dkm 5dkp 5dle 5dlt 5dlv 5dlw 5dly 5dm0 5dm1 5dm2 5dm4 5dm6 5dm7 5dm9 5dma 5dmp 5dmq 5dmu 5dn7 5dn9 5dna 5dnc 5dnd 5dne 5do6 5do9 5dof 5doi 5dok 5dox 5doy 5dpn 5dpz 5dq0 5dq1 5dq2 5dq4 5dq5 5dq8 5dqf 5dql 5dr1 5dr3 5dr4 5dr7 5dr8 5drb 5drs 5drw 5drx 5ds3 5dsd 5dse 5dsg 5dss 5dsy 5dt9 5du1 5dvw 5dvz 5dwa 5dwb 5dwc 5dwm 5dwn 5dyj 5dz5 5dz8 5dz9 5dza 5dzf 5dzj 5dzt 5dzz 5e0e 5e0i 5e0n 5e1e 5e1f 5e1s 5e23 5e2m 5e2n 5e2x 5e3f 5e3k 5e3t 5e3u 5e3x 5e4a 5e4h 5e4i 5e4o 5e4q 5e4s 5e51 5e52 5e53 5e54 5e55 5e5a 5e5i 5e5r 5e5u 5e6i 5e6p 5e7b 5e7f 5e7i 5e7j 5e7l 5e7m 5e7s 5e7t 5e80 5e8f 5e95 5e99 5e9e 5e9t 5e9u 5e9z 5eav 5eb6 5eb7 5ebb 5ebe 5ech 5eci 5eck 5ecl 5ecm 5ecn 5eco 5ecp 5ecq 5ecr 5ecs 5ect 5ed4 5ed7 5edd 5edv 5ee7 5ef5 5efi 5efm 5efw 5efx 5eg2 5egb 5ege 5egh 5egt 5ehd 5ehe 5ehk 5ein 5eio 5ej2 5ejn 5eju 5ekb 5ekd 5ekk 5ekl 5eks 5el0 5elv 5elz 5emc 5emp 5emq 5eng 5enu 5enw 5eo6 5eot 5eou 5eox 5eoy 5ep7 5epb 5epe 5epf 5epp 5epq 5epv 5eqw 5eqz 5er6 5eri 5erw 5esa 5esp 5et3 5eth 5etk 5etl 5etm 5etn 5eto 5etp 5etq 5etr 5ets 5ett 5etv 5evm 5evy 5ewe 5ewf 5ewg 5ewn 5ewo 5ex6 5ex8 5ex9 5exd 5exe 5exh 5exi 5exj 5exk 5exo 5exu 5exy 5exz 5eyu 5ez4 5ezp 5f09 5f0g 5f12 5f15 5f19 5f1a 5f1g 5f23 5f2d 5f2h 5f2k 5f2n 5f2o 5f2u 5f36 5f3a 5f3o 5f3p 5f3q 5f44 5f46 5f47 5f48 5f49 5f4h 5f4y 5f55 5f56 5f5l 5f5n 5f5p 5f5w 5f5y 5f68 5f69 5f6a 5f6h 5f6i 5f6j 5f70 5f71 5f7d 5f7f 5f7h 5f83 5f8b 5f92 5f9j 5f9p 5f9s 5f9t 5fa3 5fa4 5faa 5far 5fb9 5fba 5fbb 5fbc 5fbd 5fbf 5fbg 5fbs 5fbt 5fbu 5fby 5fc2 5fc3 5fcf 5fch 5fci 5fcj 5fd2 5fda 5fdk 5fdw 5ffx 5fg3 5fgr 5fgs 5fgy 5fha 5fhb 5fhc 5fhi 5fhm 5fhn 5fho 5fi0 5fi1 5ghl 5giq 5giu 5giv 5giz 5gj4 5gjs 5gl7 5glg 5gmq 5goy 5gpd 5gpg 5grr 5gse 5gsq 5gu6 5gu7 5guw 5gux 5gv1 5gvu 5gw7 5gxb 5gxo 5gyd 5gyk 5gzx 5gzz 5h1w 5h46 5h5m 5h6h 5h6j 5h7w 5h85 5h8b 5h8e 5h8g 5h9c 5ha6 5hau 5hax 5hay 5haz 5hb0 5hb1 5hb2 5hb3 5hb4 5hb5 5hb6 5hb7 5hb8 5hbb 5hca 5hcb 5hcf 5hci 5hcl 5hcn 5hco 5hcp 5hcq 5hcr 5hct 5hd1 5hd6 5hda 5hdl 5hdy 5he0 5he1 5he2 5he3 5heb 5hed 5hee 5het 5hey 5hf1 5hf4 5hfb 5hfc 5hfd 5hfe 5hff 5hfk 5hfn 5hg0 5hgt 5hgw 5hhz 5hi6 5hio 5hip 5hiq 5his 5hj1 5hj5 5hjl 5hjx 5hjy 5hk1 5hk2 5hk4 5hkj 5hkk 5hl8 5hlf 5hly 5hlz 5hm7 5hmd 5hmn 5hn3 5hn4 5hn5 5hn6 5hns 5hop 5hoz 5hpi 5hpk 5hpl 5hpo 5hps 5hpt 5hqm 5hqx 5hrn 5hrp 5hrr 5hrs 5hrt 5hs5 5ht0 5ht9 5hts 5hu9 5hur 5hvj 5hvk 5hw2 5hwj 5hws 5hx0 5hxm 5hy7 5i00 5i02 5i03 5i06 5i07 5i09 5i0l 5i0p 5i12 5i1n 5i1o 5i1s 5i2z 5i30 5i3e 5i3m 5i43 5i4m 5i4o 5i69 5i6w 5i6y 5i7e 5i7f 5i7s 5i7v 5i8l 5i8w 5i90 5i99 5i9j 5i9l 5i9m 5i9n 5i9u 5i9v 5i9w 5i9x 5i9y 5i9z 5ia0 5ia1 5ia2 5ia3 5ia4 5ia5 5iaw 5ick 5id6 5idv 5idw 5idx 5idy 5if3 5ifl 5ify 5ig2 5ihv 5ii4 5ii5 5ii7 5ii8 5ii9 5iia 5iib 5iic 5iif 5ijq 5ijs 5ikb 5iln 5ilq 5inf 5ing 5ini 5io5 5io6 5io7 5ipy 5iq7 5iq9 5iqa 5iqb 5iqc 5iqd 5iqe 5iqf 5iqg 5iqh 5iqi 5iqq 5iqz 5ir0 5irp 5is4 5isj 5isk 5isr 5iuj 5iuk 5iul 5ium 5iun 5iv4 5iwa 5ixu 5iz2 5iz4 5izt 5j11 5j12 5j13 5j1z 5j22 5j25 5j2o 5j3b 5j46 5j49 5j4b 5j4c 5j4h 5j4k 5j4l 5j4m 5j6b 5j6p 5j7x 5j9m 5j9n 5j9o 5jav 5jay 5jb8 5jb9 5jba 5jbb 5jbc 5jd3 5jd4 5jd5 5jd6 5jd8 5jec 5jed 5jee 5jei 5jfd 5jfg 5jfo 5jfy 5jgm 5jgo 5jj2 5jj5 5jjm 5jk5 5jk6 5jk8 5jm7 5jm8 5jmx 5job 5jp4 5jps 5jpz 5jqf 5jqq 5jr2 5jrg 5jrj 5jrk 5jrl 5jrq 5jry 5jsc 5jsm 5jsv 5jsw 5jt2 5jt5 5jt6 5jt7 5jzy 5k16 5k19 5k1a 5k1b 5k1c 5k1r 5k1x 5k36 5k4g 5k4h 5k7y 5k89 5k9f 5k9h 5kbr 5kcg 5kda 5kdd 5kee 5kf0 5kgu 5kha 5kia 5kix 5kk5 5kkp 5kkv 5kl9 5kmt 5kmu 5kmw 5knb 5knc 5knd 5kni 5kob 5koh 5koj 5kol 5kou 5kov 5kq1 5kq4 5krb 5kru 5ksq 5kvk 5kwb 5kwr 5kxv 5kza 5kzb 5kzl 5l0b 5l0e 5l0k 5l2e 5l2h 5l4q 5l4z 5l50 5l6p 5l7f 5l84 5l88 5l8c 5l8y 5l9h 5lce 5ld5 5ldy 5lew 5ljf 5lka 5llt 5lm3 5lo9 5lpd 5lpo 5lpp 5lpq 5lps 5lpt 5ls9 5lsf 5lth 5lti 5lwe 5lwr 5lxh 5lxq 5m0x 5m11 5m16 5m2e 5m2f 5m4v 5m6p 5m9w 5mam 5mb0 5mb3 5mb5 5mb6 5mb7 5mee 5mg0 5mh5 5mhi 5mhl 5mhm 5mhn 5mho 5mhr 5mhs 5mix 5mj0 5mj1 5mj2 5mjn 5mjt 5mls 5mm3 5mm6 5mmv 5mmz 5mn1 5mna 5mnb 5mnc 5mne 5mnf 5mng 5mnh 5mnl 5mnm 5mnn 5mno 5mnp 5mnq 5mnr 5mnx 5mny 5mnz 5mo0 5mo1 5mo2 5mog 5mon 5moo 5mop 5mor 5mos 5mqm 5mqn 5mqo 5mqp 5mqr 5mqs 5mr2 5mr3 5mtj 5mtk 5mtp 5mtq 5mtr 5mu9 5mua 5mun 5mw8 5mwk 5mwl 5mwm 5mzl 5n1d 5n1e 5n1f 5n1g 5n1h 5n1k 5n1l 5n1m 5n1n 5n1o 5n2t 5n2x 5n2z 5n31 5n32 5n33 5n34 5n36 5n37 5n39 5n3a 5n3b 5n3c 5n3d 5n3e 5n3f 5n3g 5n3h 5n3i 5n3j 5n3k 5n3l 5n3m 5n3n 5n3p 5n3q 5n3r 5n3s 5n3t 5n3v 5n3y 5n4n 5n4o 5n4r 5n4u 5n4v 5n4x 5n4y 5n51 5n52 5n5d 5n5l 5n5m 5n6f 5n6h 5n6l 5n6m 5n7p 5n7u 5n83 5n85 5n8a 5n8d 5naf 5nb4 5nbe 5nbh 5nc1 5ncs 5nct 5ncu 5ncw 5ndt 5nfe 5nfv 5nfw 5ng6 5ngk 5ngl 5nji 5nkt 5nl0 5nnd 5nne 5nnf 5nng 5noh 5npq 5npr 5nps 5nsj 5ntj 5nuo 5nup 5nuq 5nur 5nuz 5nv6 5nvg 5nw8 5nyw 5nzb 5nzc 5o0e 5o0s 5o1w 5o1x 5o1y 5o1z 5o20 5o2l 5o2w 5o5m 5o5r 5o5t 5o5u 5o63 5o78 5o7t 5o8f 5oco 5oct 5oe3 5oe4 5oe5 5oe6 5of0 5og9 5ogb 5oh6 5ohs 5ohx 5oix 5oiy 5oiz 5oj0 5oj1 5oje 5ojm 5ojw 5ojz 5ok0 5ok1 5ok2 5ok3 5ol3 5ol5 5ol6 5ol7 5olp 5olq 5olr 5ols 5omq 5omt 5op0 5opj 5opk 5opm 5opn 5opo 5opp 5ot0 5ot1 5ot3 5ote 5otf 5otg 5oua 5ouc 5ous 5ov4 5ov5 5ov6 5ovw 5oxj 5oyh 5sak 5sal 5sam 5san 5sao 5sap 5saq 5sar 5sas 5sat 5scm 5scn 5sco 5scp 5scq 5scr 5scs 5sct 5scu 5scv 5scw 5scx 5scy 5scz 5sd0 5sd1 5sd2 5sd3 5sd4 5sd5 5sd6 5sd7 5sd8 5sd9 5sda 5sdb 5suz 5svd 5sw0 5sw3 5swk 5sy5 5sy7 5syd 5syn 5szt 5t06 5t07 5t30 5t3x 5t3z 5t4m 5t4n 5t5q 5t6n 5t6s 5t83 5t8z 5t96 5t9i 5t9k 5t9q 5t9y 5tac 5tad 5tae 5tai 5taj 5tak 5tar 5tb5 5tb6 5tbx 5tc8 5tcl 5tcx 5te4 5te6 5te7 5teb 5tf4 5tfr 5tgd 5tgs 5tgt 5th5 5the 5thq 5thw 5thx 5tj3 5tjg 5tma 5tnu 5tnx 5too 5tpl 5tpp 5tqa 5tqi 5tqm 5tqr 5tqv 5tr9 5trc 5trp 5trw 5ts9 5tt4 5ttg 5tuo 5tvi 5tvr 5tvs 5tvv 5tvy 5tw1 5txw 5tzo 5u08 5u0r 5u0u 5u15 5u1p 5u26 5u27 5u2w 5u4s 5u5q 5u8j 5u8p 5u98 5u9a 5u9i 5u9j 5u9k 5u9l 5u9p 5uan 5ub8 5ubo 5uc7 5ucc 5uda 5udc 5udd 5ude 5udf 5udi 5ue7 5uen 5ueo 5uep 5ueq 5uer 5ues 5uet 5ueu 5uev 5uew 5uex 5uey 5uez 5uf0 5uf2 5uf8 5ufa 5ufm 5ufn 5ufy 5ug1 5ugs 5ugt 5ugu 5uix 5uiz 5uju 5uk4 5uk8 5ukb 5ukj 5ul1 5um0 5um7 5umb 5unb 5unl 5uof 5upg 5upr 5ur0 5ur8 5us1 5uth 5uti 5utj 5uvl 5uvs 5uvt 5uvu 5uvv 5uvw 5uvx 5uvy 5uvz 5uxa 5uxb 5uxc 5uxd 5v0t 5v0w 5v0x 5v35 5v38 5v3c 5v4g 5v4h 5v4i 5v4r 5v60 5v61 5v62 5v77 5v7c 5v7i 5v7k 5v7l 5v7m 5v87 5v8c 5va0 5va7 5vae 5vaf 5val 5vbd 5vc1 5vcq 5vct 5vcu 5ve7 5ve8 5vfh 5vfj 5vfm 5vfn 5vh3 5vh4 5vh5 5vir 5vix 5vj9 5vjb 5vjc 5vkw 5vm2 5vn2 5vn4 5vn6 5vof 5vp2 5vph 5vps 5vqb 5vqi 5vsl 5vsm 5vsn 5vtp 5vu3 5vve 5vxn 5vxt 5vy2 5vye 5vyv 5w0t 5w0v 5w0w 5w12 5w13 5w14 5w15 5w1n 5w21 5w3d 5w3t 5w3v 5w3x 5w3y 5w40 5w43 5w46 5w4k 5w5h 5w5i 5w6x 5w6z 5w7z 5w8n 5w8s 5w8x 5wac 5wad 5wae 5waf 5wag 5wdi 5we0 5we1 5we2 5wis 5wit 5wjc 5wly 5wn9 5wnb 5wnn 5wp4 5wp5 5wps 5wpu 5wq0 5wql 5wr9 5wra 5wrb 5wrc 5ws3 5ws4 5wso 5wsz 5wwq 5wy0 5wy1 5x0o 5x49 5x5x 5x5y 5x6d 5x6e 5x8n 5x9u 5x9v 5xaj 5xet 5xev 5xf7 5xhe 5xi5 5xku 5xm3 5xn0 5xn1 5xn2 5xpe 5xpf 5xpt 5xpu 5xqh 5xqi 5xqn 5xqp 5xqr 5xqu 5xqv 5xr0 5xsv 5xsw 5xsx 5xv7 5xzb 5xzr 5y14 5y29 5y2a 5y2b 5y2c 5y2x 5y2y 5y3n 5y3o 5y5f 5y8x 5y9d 5yak 5ybc 5ybh 5ybx 5yc2 5yca 5yfj 5yfs 5yft 5yfu 5yfv 5yfw 5yfx 5yg5 5yg6 5yg7 5yg8 5yg9 5yga 5ygm 5yh1 5yhm 5yig 5yjs 5yk6 5ykc 5ykp 5yl3 5ylg 5ynx 5yny 5yp5 5yp6 5yq2 5yqb 5yr4 5ysg 5ysp 5ysq 5yss 5ysz 5yt8 5yt9 5ytz 5yx2 5yxf 5yxm 5yxw 5yy2 5yy3 5yzc 5yzd 5yze 5yzm 5yzn 5yzo 5z34 5z40 5z41 5z42 5z47 5z48 5z88 5z98 5z9x 5zcx 5zcy 5zee 5zef 5zeg 5zeh 5zei 5zej 5zem 5zgc 5zh8 5zj4 5zj5 5zk4 5zle 5zlg 5zob 5zq2 5zq3 5zq4 5zq5 5zq6 5zq7 5zql 5zt2 5ztk 5ztl 5zug 5zyr 5zzn 6a0x 6a0z 6a15 6a16 6a17 6a18 6a34 6a35 6a4r 6a4s 6a4t 6a5e 6a5f 6a5g 6a5h 6a76 6a77 6a78 6a79 6a8m 6a8u 6a8z 6a9t 6a9u 6a9v 6ab9 6aba 6aez 6agh 6agq 6ahg 6ais 6al6 6al7 6al8 6ala 6all 6alv 6am0 6amo 6amp 6an2 6an3 6an8 6anq 6anr 6ans 6anz 6ao6 6ao7 6ao8 6aod 6aoj 6aok 6apb 6apc 6aph 6apk 6apm 6ar7 6arx 6ary 6as9 6asl 6asw 6au2 6au3 6au8 6auj 6avl 6avm 6avt 6awe 6axa 6ay0 6ay4 6ay6 6ayb 6ayc 6b09 6b2l 6b37 6b3e 6b3l 6b4q 6b4t 6b55 6b56 6b5c 6b5d 6b5f 6b6k 6b6p 6b6q 6b6r 6b6s 6b6t 6b6u 6b71 6b7a 6b7b 6b7c 6b7d 6b7e 6b7f 6b7i 6b80 6b81 6b83 6b84 6b89 6b9x 6bb4 6bb7 6bc8 6bcd 6bcs 6bea 6beb 6bec 6bed 6bee 6bef 6beg 6beh 6bei 6bfv 6bhb 6bhw 6bhx 6bhz 6bi0 6bi1 6bi2 6bi7 6bi9 6bif 6bj6 6bj7 6bl5 6bld 6blj 6bme 6bnc 6bnd 6bne 6bnf 6bng 6bnm 6bny 6bo1 6bo2 6bod 6boe 6brd 6bri 6brj 6brl 6brr 6bs7 6bsk 6bt4 6bvc 6byp 6byq 6byt 6byx 6c0d 6c25 6c29 6c2g 6c2m 6c2n 6c2o 6c3i 6c46 6c4j 6c4k 6c4u 6c58 6c5a 6c5u 6c5z 6c7c 6c87 6c8q 6c90 6c9e 6cae 6can 6cav 6cax 6cb5 6cbj 6cbp 6ccr 6cdd 6ce1 6cep 6cey 6cfj 6cfk 6cfl 6cga 6cgd 6cgg 6ch4 6chv 6cii 6cja 6cjb 6cji 6cjj 6cjl 6cjp 6cjr 6cjs 6ck4 6ck5 6cka 6ckp 6ckt 6cmp 6cmq 6cmr 6cms 6cn7 6cpe 6cpf 6cpg 6cq0 6cq3 6cq4 6cq5 6cq6 6cq8 6cq9 6cs9 6csu 6csv 6cum 6cuq 6cv6 6cvw 6cvx 6cvy 6cw5 6cx2 6cx3 6cx4 6cx8 6cy6 6cz6 6d0q 6d0r 6d13 6d1q 6d1v 6d21 6d2j 6d2k 6d2m 6d2n 6d2o 6d2q 6d2w 6d2x 6d2y 6d33 6d38 6d39 6d3u 6d42 6d4b 6d4c 6d52 6d5s 6d6j 6d6k 6d9n 6d9r 6d9y 6d9z 6da0 6da1 6dam 6dat 6dav 6db5 6db6 6db7 6db8 6db9 6dbb 6dbs 6dc7 6dc8 6dc9 6dca 6dce 6dej 6dgx 6dgy 6dgz 6dh0 6dh1 6dh2 6dh3 6dh4 6dh5 6dh6 6dh7 6dh8 6diq 6dir 6dis 6dit 6diu 6div 6diw 6dkg 6dki 6dkw 6do1 6dtw 6dtx 6du6 6dui 6e0s 6e1j 6e1x 6e37 6e3n 6e3u 6e52 6e60 6e61 6e8l 6e95 6e9b 6eb8 6eb9 6ec2 6ecb 6ecc 6ecf 6ecn 6eco 6edd 6edh 6eds 6eeb 6efw 6efx 6egw 6eh0 6eh2 6eh3 6ek9 6ekn 6eko 6ela 6em2 6em6 6em7 6ema 6emb 6emd 6emy 6en0 6ene 6eon 6eox 6ep4 6epg 6eph 6epi 6eqp 6eqq 6erg 6erh 6ero 6erp 6erq 6ers 6ert 6eru 6erv 6erw 6esa 6esj 6esy 6esz 6et0 6et2 6et3 6ety 6eu5 6eur 6ewf 6ex3 6ex4 6ex5 6exf 6exp 6ez9 6ezi 6ezr 6ezs 6ezt 6ezw 6f0d 6f14 6f2a 6f2b 6f2e 6f37 6f45 6f56 6f57 6f6j 6f7l 6f9n 6f9s 6f9w 6fah 6fbu 6fch 6fci 6fdd 6fdl 6fe5 6ff1 6ff2 6fft 6fga 6fh1 6fh2 6fh3 6fh4 6fha 6fhb 6fjt 6fm2 6fmg 6fmn 6fne 6fnx 6fo5 6foz 6fpp 6fpq 6fpu 6fpv 6fpx 6fq1 6fqr 6fre 6frg 6frh 6frr 6fsd 6fse 6fso 6fuk 6ful 6fv3 6fv4 6fv5 6fw2 6fy0 6fy1 6fy2 6fy3 6fz2 6fz3 6fz5 6g0d 6g0e 6g0f 6g0g 6g0h 6g3o 6g50 6g52 6g56 6g58 6g59 6g5l 6g5u 6g61 6g62 6g6t 6g7a 6g7z 6g8f 6g96 6g9x 6gax 6gb0 6gb4 6gb9 6gbc 6gbf 6gbw 6gc5 6gdc 6gf6 6gf7 6gf8 6gh1 6gh4 6ghb 6ghd 6gho 6gie 6gjg 6gm9 6goc 6gpu 6gpv 6grw 6gry 6gs0 6gsg 6gt5 6gtb 6gu8 6gx6 6gxv 6gya 6gza 6h07 6h0t 6h0v 6h18 6h19 6h1a 6h1m 6h1n 6h1z 6h2x 6h62 6h7y 6h7z 6h8k 6h8r 6h8s 6h8u 6h8v 6h8w 6h8x 6h8y 6h8z 6h90 6h91 6h92 6h93 6h94 6hal 6hcl 6heh 6hei 6hej 6hek 6hel 6hem 6hgq 6hgr 6hgs 6hhm 6hhn 6hjd 6hkj 6hm6 6hm7 6hme 6hmw 6hmy 6hpv 6hqx 6hr3 6hr5 6hrw 6hrx 6hry 6hrz 6hs0 6hs1 6hs2 6hsc 6ht7 6hur 6hus 6hv6 6hwg 6hwo 6hxd 6hze 6hzf 6hzg 6i0b 6i0c 6i0s 6i0t 6i0u 6i0v 6i0w 6i1d 6i1k 6i1l 6i1u 6i2a 6i2b 6i2c 6i2d 6i2f 6i2h 6i3e 6i4x 6i5j 6i5n 6i8g 6i8h 6ial 6ibh 6ibi 6ics 6idc 6idn 6ido 6iei 6iew 6iff 6ifg 6igp 6igq 6igr 6igx 6ii0 6ii2 6ii6 6iie 6iig 6ij3 6ij4 6ij5 6ij6 6ijl 6ijt 6ik5 6ik6 6ik7 6ik8 6ikg 6ilz 6in5 6int 6iqc 6iqo 6iqq 6iqr 6iqs 6iqu 6iru 6ite 6iys 6izj 6izx 6izy 6izz 6j00 6j0p 6j0v 6j0w 6j0x 6j0y 6j26 6j27 6j28 6j5m 6j5n 6j5o 6j5p 6j5q 6j5r 6j6b 6j6c 6j6d 6j6e 6j7c 6j8y 6j9k 6j9l 6j9m 6j9n 6j9w 6j9y 6jad 6jag 6jah 6jai 6jal 6jam 6jan 6jao 6jap 6jaq 6jar 6jaz 6jb0 6jb4 6jba 6jbb 6jbe 6jbm 6jc5 6jc6 6jcf 6jcg 6jd2 6jig 6jir 6jky 6jl8 6jnh 6jog 6jqk 6jqt 6jul 6jum 6jun 6juo 6jup 6juq 6jur 6jus 6jv9 6jvb 6jve 6jx8 6jze 6k0e 6k0f 6k1t 6k26 6k2m 6k2p 6k2r 6k2s 6k2t 6k2v 6k2w 6k4h 6k4z 6k6i 6k6j 6k6k 6k8m 6k8x 6k98 6k9d 6k9t 6ka5 6kaw 6kbc 6kcj 6kel 6kem 6ken 6keo 6kep 6keq 6ker 6kfq 6kgd 6kge 6kgf 6kht 6kik 6kiy 6kjg 6kji 6kk8 6kk9 6kkh 6kl4 6km8 6kmm 6kmn 6kol 6koy 6koz 6kp0 6kp1 6kpb 6kpd 6krl 6kto 6kts 6ku3 6kue 6kun 6kvx 6kwj 6kwu 6kwv 6kyf 6kzb 6kzd 6l0t 6l0u 6l0y 6l2i 6l2j 6l2k 6l2r 6l2s 6l2z 6la0 6lan 6lbc 6lbd 6lbi 6lbm 6lbp 6lbr 6lbs 6lbt 6lbu 6le5 6leu 6lev 6lez 6lfa 6lgw 6lgx 6lh6 6ljy 6lk0 6lk4 6lkp 6ll8 6lqw 6lra 6lrd 6ls9 6lsa 6lyh 6lyi 6lzb 6lzc 6lzi 6lzj 6lzk 6m4i 6m80 6m84 6m86 6m8t 6m8u 6m8v 6mao 6mdt 6mdx 6mfm 6mfu 6mg6 6mgj 6mgk 6mgl 6mgr 6mgu 6mh4 6mh5 6mi6 6mij 6mmz 6mn0 6mn1 6mn2 6mn3 6mn5 6mnc 6mom 6mq3 6mqh 6mr4 6ms1 6msw 6mtk 6mtz 6mw5 6mw8 6mwe 6mwf 6mwi 6mwj 6mxt 6mye 6myf 6mze 6mzf 6mzg 6n05 6n1c 6n1f 6n2l 6n45 6n56 6n67 6n9e 6n9f 6nab 6nb0 6ncs 6nd5 6nd6 6ndk 6ndr 6nds 6nek 6nep 6nes 6net 6neu 6nev 6nh9 6nhi 6nid 6njt 6nju 6njz 6nk2 6nle 6nlo 6nmo 6nmq 6nov 6nps 6npt 6nq4 6nr0 6nsh 6nsp 6nss 6nta 6ntc 6ntd 6nu1 6nu5 6nu9 6nub 6nuo 6nup 6nvb 6nwy 6ny9 6o15 6o2d 6o2h 6o2k 6o3m 6o5g 6o62 6o6k 6o6q 6o86 6o87 6o88 6o8q 6o97 6oaj 6oav 6obh 6oc0 6oc1 6ocf 6od2 6od8 6oe6 6oew 6of1 6ohz 6oim 6ojm 6okh 6ol5 6olx 6om5 6om8 6on6 6onb 6oog 6ooi 6oos 6oot 6oou 6ops 6opt 6opu 6opv 6opw 6opx 6opy 6opz 6os7 6osi 6ov6 6ovk 6ovp 6owv 6oww 6ox6 6oxm 6oxo 6oxp 6oxq 6oxr 6oxs 6oxt 6oxu 6oxv 6oxw 6oxx 6oxy 6oxz 6oy0 6oy1 6oy2 6oz1 6ozd 6p1d 6p2k 6p2l 6p2m 6p2n 6p2o 6p3j 6p3q 6p45 6p4o 6p4w 6p4x 6p59 6p61 6p66 6p6p 6p6x 6p6y 6p81 6p8m 6p8n 6p8w 6p8x 6p8y 6p8z 6pbl 6pcx 6pd3 6pd5 6pd6 6pf2 6pfp 6pgi 6pgo 6pgp 6ph2 6ph3 6ph4 6phe 6pi4 6pi9 6piu 6piv 6piw 6pix 6piy 6piz 6pj0 6pj1 6pj2 6pjb 6pjc 6pjd 6pje 6pjf 6pjg 6pjh 6pji 6pjk 6pjl 6pjm 6pjn 6pjo 6pjw 6ple 6pln 6pnk 6pqh 6pqn 6pr6 6pta 6ptg 6pu1 6pu6 6pwd 6pwg 6pwl 6pwm 6pyk 6pyo 6pyx 6pzj 6pzl 6pzm 6pzn 6q09 6q0p 6q2u 6q32 6q3v 6q40 6q4s 6q63 6q64 6q70 6q71 6q72 6q7u 6qaa 6qab 6qac 6qad 6qae 6qbv 6qdj 6qdl 6qdm 6qf1 6qf2 6qf3 6qf4 6qf5 6qgp 6qgr 6qhj 6qib 6qic 6qjf 6qjg 6qji 6qjj 6qjl 6qkg 6qkr 6qkx 6ql1 6ql2 6ql3 6qm3 6qmo 6qn4 6qnw 6qq4 6qrr 6qrs 6qrt 6qru 6qrv 6qrw 6qrx 6qry 6qrz 6qv8 6qv9 6qwt 6qxv 6qxw 6qxx 6qxy 6qy0 6qy1 6qy2 6qy4 6qy5 6qzm 6qzn 6r26 6r27 6r4s 6r4t 6r4u 6r5d 6r5e 6r5w 6r6f 6r6j 6r6y 6r71 6r8i 6rb2 6rb4 6rb5 6rfh 6rg5 6rh4 6rhv 6rhw 6rig 6rit 6rjj 6rjk 6rkq 6rkt 6rl5 6rl9 6rlm 6rlo 6rlr 6rm1 6rmp 6rmx 6rmy 6rnp 6rnq 6rns 6ro8 6rob 6rof 6rot 6rpp 6rqi 6rrg 6rri 6rs2 6rs5 6rs6 6rs7 6rs8 6rs9 6rso 6rsp 6rsx 6rsz 6rtd 6rte 6rtg 6rth 6ruu 6s08 6s0a 6s0b 6s0d 6s3x 6s48 6s49 6s6r 6s7d 6s7m 6s7x 6s7y 6s9y 6sa0 6sa1 6sam 6sbu 6sbv 6scb 6scr 6scx 6sdf 6sep 6sg4 6sgp 6sh6 6sh7 6skh 6sma 6snn 6snx 6sox 6spm 6sps 6spu 6spy 6sq1 6srv 6srx 6ss0 6ss2 6ss4 6ss5 6ss6 6stc 6ste 6stk 6sub 6suc 6sur 6sxj 6sy6 6sy9 6syj 6syw 6t1e 6t1g 6t1k 6t27 6t2b 6t2l 6t2n 6t2o 6t2p 6t2q 6t2r 6t2s 6t2y 6t2z 6t30 6t31 6t32 6t3p 6t4n 6t4o 6t4p 6t5c 6t5g 6t5p 6t5q 6t6c 6t7q 6t81 6t9t 6t9u 6t9v 6ta7 6ta8 6tcb 6td4 6td8 6tde 6te1 6tej 6tfd 6tfo 6tgx 6th0 6th4 6the 6thf 6thv 6ti2 6tju 6tl7 6tla 6tnj 6tnm 6toq 6tp5 6trk 6tsz 6tuc 6tuf 6tug 6tv3 6tv6 6twj 6twk 6twl 6twm 6tww 6txd 6txp 6ty5 6tyh 6tzf 6tzg 6tzh 6tzi 6tzj 6tzu 6u01 6u0o 6u3l 6u3z 6u4q 6u4r 6u4t 6u4x 6u5a 6u5i 6u60 6u69 6u6a 6u76 6u83 6ucq 6ude 6udf 6udg 6uds 6ue3 6ue4 6uew 6ufm 6ufs 6uht 6uhx 6ujd 6ul2 6ul4 6ul6 6ulo 6umg 6umh 6umi 6umj 6umq 6umr 6unc 6unv 6uo1 6us8 6us9 6uso 6usp 6usq 6usr 6utk 6uug 6uuh 6uul 6uum 6uut 6uuv 6uvo 6uz6 6uzg 6uzr 6uzw 6uzx 6v02 6v2m 6v6w 6v74 6v75 6v76 6v7u 6v7v 6v7w 6v7x 6v8e 6v8h 6v8j 6v8l 6v8m 6v8s 6v97 6vat 6vbx 6vck 6vcl 6vcm 6vcn 6vco 6vcp 6vcq 6vcr 6veo 6vho 6vht 6vhu 6vhv 6vhw 6vhx 6vhy 6vhz 6vif 6vlt 6vlw 6vmy 6vop 6voq 6vp4 6vp5 6vpy 6vrq 6vt2 6vtu 6vvq 6vw7 6vw9 6vwa 6vxs 6vyn 6vz0 6vzd 6vze 6vzz 6w01 6w02 6w04 6w11 6w1b 6w1w 6w2b 6w2c 6w2g 6w2h 6w2i 6w2z 6w33 6w34 6w46 6w47 6w49 6w4l 6w4t 6w4u 6w56 6w57 6w59 6w6q 6w6r 6w6s 6w6t 6w7b 6w7c 6w7d 6w7e 6w7x 6w9p 6wb4 6wb5 6wb7 6wcd 6wcw 6wdz 6we0 6we1 6web 6wec 6wes 6wfi 6wfm 6wfv 6wg4 6wg6 6wgt 6wgy 6wgz 6wh0 6wh4 6whj 6whp 6wiq 6wiw 6wj8 6wlx 6wly 6wm5 6wmv 6wn4 6wnk 6wom 6won 6wop 6wp3 6wp4 6wp5 6wp6 6wpr 6wqb 6wqc 6wqm 6wrk 6wrn 6wrp 6wrq 6wrt 6wsh 6wsk 6wt2 6wt3 6wta 6wu5 6wu7 6wud 6wuw 6wvs 6wvv 6ww6 6wwd 6wxc 6wxo 6wxp 6wy6 6wyr 6wyt 6x1b 6x3k 6x3q 6x42 6x7q 6x7r 6x7s 6x84 6x90 6x9l 6xa2 6xa3 6xa9 6xaa 6xd0 6xd1 6xdk 6xep 6xeq 6xf1 6xf2 6xf3 6xf4 6xf9 6xgs 6xhv 6xhw 6xhx 6xhy 6xi1 6xi3 6xi4 6xi5 6xix 6xj4 6xje 6xjf 6xjl 6xjm 6xk0 6xlz 6xnc 6xnj 6xnq 6xoc 6xqd 6xqe 6xr5 6xrb 6xrf 6xrh 6xrr 6xru 6xsd 6xsn 6xst 6xt0 6xt5 6xt6 6xt7 6xta 6xum 6xwe 6xws 6xwt 6xwu 6xwv 6xxg 6xxq 6xy4 6xy6 6xya 6xys 6xyu 6xyy 6xz0 6xzu 6y01 6y02 6y03 6y05 6y0b 6y1p 6y1y 6y2n 6y2o 6y2u 6y3b 6y4b 6y4i 6y5x 6y5y 6y5z 6y60 6y61 6y63 6y64 6y65 6y66 6y67 6y6a 6y6c 6y84 6y89 6y8c 6y9h 6y9i 6yar 6yay 6yb5 6yb6 6ybb 6ybf 6ybi 6ybo 6ybr 6ybu 6ybx 6yc5 6yc7 6yd2 6yd3 6yd4 6yd7 6ye0 6ye6 6ye7 6ye8 6yeb 6yec 6yed 6yfw 6yfx 6yge 6ygf 6ygg 6ygk 6ygl 6ygm 6ygo 6ygp 6ygq 6ygr 6ygs 6ygv 6ygw 6ygx 6ygy 6ygz 6yh1 6yh2 6yh3 6yh4 6yh5 6yh6 6yh7 6yh8 6yh9 6yha 6yhb 6yhc 6yhd 6yhe 6yhg 6yhj 6yi6 6yi8 6yiq 6yir 6yj1 6ylu 6ylz 6ymh 6ymp 6ymq 6ymr 6yms 6ymz 6yn3 6yna 6ynb 6ync 6ynr 6ynt 6yot 6you 6ypp 6yps 6yqf 6yqi 6yqj 6yqk 6yqv 6yrs 6yry 6ysj 6ysv 6ysw 6ysx 6yur 6yuu 6ywz 6yx0 6yx1 6yx2 6yx7 6yx8 6yxk 6yxm 6yyz 6yz1 6yzz 6z00 6z08 6z0d 6z1h 6z1m 6z2a 6z2g 6z2s 6z30 6z31 6z32 6z3d 6z44 6z79 6z7a 6z7b 6z7c 6z7d 6z7e 6z7t 6z7u 6z9h 6z9i 6z9j 6zbn 6zbo 6zcj 6zfw 6zgo 6zh1 6zh7 6zie 6zif 6zj8 6zk7 6zl1 6zn0 6znp 6znq 6zns 6zpn 6zq2 6zrw 6zsu 6zsv 6zsy 6zsz 6zt0 6zyk 6zyl 6zz2 7a0b 7a0d 7a0e 7a0f 7a0w 7a0x 7a0y 7a17 7a19 7a1a 7a1u 7a3v 7a3x 7a4k 7a4x 7a62 7a6d 7a8s 7a9e 7a9g 7a9h 7a9w 7a9x 7a9y 7a9z 7aa0 7aa1 7aa4 7aaj 7ab8 7aba 7abb 7abx 7ac9 7acg 7aci 7adg 7adn 7adw 7aen 7aeq 7aes 7agn 7agq 7agr 7ags 7agt 7agu 7ahb 7ahr 7ahx 7ai2 7ai3 7ai8 7ai9 7aid 7aif 7aig 7aii 7aij 7aj0 7akc 7amz 7an5 7ape 7apl 7apm 7aqh 7aqx 7aqy 7aqz 7ar0 7aui 7auj 7auk 7aul 7aum 7aun 7auo 7aup 7auq 7aur 7aus 7aut 7auu 7ave 7avf 7avg 7avm 7awg 7awh 7awi 7axt 7axv 7axw 7axy 7ayw 7azv 7b0d 7b0m 7b13 7b15 7b19 7b1a 7b1u 7b26 7b28 7b29 7b2a 7b2d 7b2i 7b2j 7b2w 7b38 7b3n 7b4i 7b4j 7b4r 7b4s 7b5j 7b6s 7b6t 7b6u 7b6v 7b7n 7b8e 7b96 7baq 7bar 7bax 7bb0 7bbm 7bbq 7bca 7bcb 7bdv 7be8 7bek 7bet 7bg1 7bgm 7bgn 7bha 7bhb 7bhc 7biz 7bj3 7bkx 7bly 7bmm 7bny 7bo4 7br0 7br5 7bu5 7bys 7byt 7byu 7byv 7byw 7byx 7bzm 7c04 7c05 7c0c 7c0d 7c0e 7c0f 7c0k 7c0l 7c0o 7c0r 7c0s 7c0t 7c0u 7c0v 7c0w 7c0x 7c0y 7c0z 7c14 7c15 7c16 7c19 7c1b 7c2i 7c2j 7c3n 7c3z 7c40 7c41 7c4d 7c4l 7c4m 7c4n 7c52 7c63 7c64 7c66 7c67 7c68 7c69 7c6f 7c6g 7c6h 7c6i 7c6j 7c6k 7c6l 7c6m 7c6n 7c6r 7c6t 7c6v 7c6w 7c6x 7c6y 7c6z 7c70 7c71 7c7b 7c7c 7c8h 7c8i 7c94 7c95 7c9j 7ccx 7ccy 7ccz 7cd0 7cdc 7cdd 7cde 7cdf 7cdg 7cdk 7cdm 7cdn 7cdo 7cdp 7cdq 7cdr 7cds 7cdt 7cdu 7cfz 7chr 7cin 7cir 7cis 7cjy 7cl0 7cl1 7cla 7clt 7cnb 7cnw 7cnx 7cny 7cnz 7cp6 7cp7 7cpc 7cpi 7cr9 7cra 7crk 7crl 7crn 7crs 7crt 7crx 7cry 7ctw 7cty 7ctz 7cuh 7cui 7cuj 7cut 7cuu 7cwd 7cyw 7d0m 7d0n 7d0v 7d19 7d1c 7d1i 7d1x 7d4m 7d6q 7d6r 7d91 7d92 7d93 7d94 7d98 7d9z 7daa 7dat 7dau 7dav 7daw 7db7 7db8 7dda 7dej 7deq 7der 7dfq 7dfs 7dfy 7dhw 7dik 7dil 7dim 7din 7dis 7dit 7diu 7div 7diy 7diz 7dj0 7dji 7dk1 7dks 7dkt 7dku 7dkv 7dkw 7dkx 7dky 7dli 7dlk 7dm9 7dma 7dms 7dp3 7dpd 7dpi 7dqk 7drj 7drk 7dru 7duf 7dve 7dvu 7dvv 7dyn 7e18 7e19 7e34 7e4d 7e5q 7e5t 7e5u 7e5v 7e9s 7ea0 7ea6 7eat 7ebb 7ebg 7ebh 7ebt 7ebu 7ebv 7ed6 7ed9 7edo 7efp 7efq 7efr 7ehh 7ej9 7ejv 7em1 7em2 7em3 7em4 7em5 7em6 7em8 7em9 7ema 7emb 7emc 7emd 7eml 7emm 7erx 7es2 7esk 7esl 7esm 7esn 7etp 7etq 7evt 7ezz 7f2r 7f2y 7f2z 7f30 7f3i 7f3j 7f3k 7f3l 7f3n 7f6e 7f6f 7f6k 7f6l 7f6n 7f6o 7f6p 7f6q 7f6r 7f6s 7f6t 7f6u 7f71 7f7q 7f7r 7f84 7f8s 7f90 7fao 7fb7 7fbq 7fcn 7fct 7fdd 7fdp 7fe1 7fe2 7fe3 7fe4 7ff8 7ff9 7fgj 7fgk 7fgl 7fgr 7fh7 7fh8 7fhm 7fhp 7fhu 7fjr 7fjs 7jfn 7jh4 7jik 7jku 7jkv 7jlh 7jlk 7jln 7jm0 7jm1 7jm2 7joz 7jql 7jqm 7ju2 7jvd 7jve 7jwn 7jxh 7jxi 7jxk 7jxl 7jxm 7jxp 7jxq 7jxw 7jyp 7jz7 7jz8 7jz9 7jza 7jzb 7jzc 7jzd 7jze 7jzf 7jzg 7jzj 7jzt 7k1h 7k1i 7k3n 7k46 7k47 7k4p 7k4q 7k4r 7k4s 7k4t 7k4u 7k4v 7k4w 7k4x 7k4y 7k4z 7k5d 7k5l 7k5z 7k62 7k66 7k68 7k69 7k6a 7k6c 7k74 7k84 7kag 7kbt 7kcn 7kcp 7kd4 7kd5 7kdn 7kes 7kf3 7kg4 7kgv 7ki8 7ki9 7kii 7kij 7kik 7kio 7kir 7kiu 7kja 7kjc 7kjj 7kkz 7klc 7kli 7klp 7km7 7km8 7km9 7kmd 7kno 7knp 7kpp 7kps 7kqa 7kqv 7kqz 7kr6 7krg 7kwj 7kwm 7kwq 7kwx 7kx3 7kx6 7kx8 7kxa 7kxw 7kxz 7ky0 7ky3 7ky4 7kyd 7kye 7kyj 7kzw 7l0a 7l0d 7l21 7l2a 7l32 7l3o 7l4a 7l4c 7l4h 7l4k 7l4m 7l4n 7l6c 7l6s 7l6v 7l7l 7l7n 7l7o 7l7p 7l8h 7l8i 7l8j 7l9r 7l9u 7l9x 7lao 7lap 7lce 7lcz 7ldk 7ldy 7ldz 7le0 7le1 7le2 7le3 7le4 7le5 7le6 7le7 7le8 7le9 7lea 7leb 7lec 7led 7lee 7lef 7leh 7lei 7lg8 7lg9 7lgb 7lgo 7lh5 7lhj 7lhm 7lhn 7lin 7lio 7lip 7liq 7liu 7ljp 7lkm 7lkn 7lko 7ll0 7lli 7llj 7lo1 7lol 7lp1 7lp2 7lp3 7lrh 7ltq 7ltw 7ltx 7lu6 7luy 7lv6 7lv7 7lvo 7lvp 7lwh 7lxh 7lxj 7lyy 7lzp 7m0i 7m1h 7m2d 7m3k 7m4m 7m4n 7m4o 7m4s 7m5h 7m5i 7m5u 7m7a 7m8i 7m8s 7m8t 7m8u 7m8v 7m93 7m94 7m95 7m96 7m97 7m98 7m9g 7m9h 7m9i 7m9j 7m9k 7m9l 7m9m 7m9n 7m9o 7m9p 7m9q 7m9r 7m9s 7m9t 7m9u 7m9v 7m9w 7m9x 7m9z 7ma0 7ma1 7ma2 7ma3 7ma4 7ma5 7ma6 7ma7 7ma8 7ma9 7maa 7mab 7mac 7mad 7mae 7maf 7mag 7mah 7mai 7maj 7mak 7mal 7man 7mao 7map 7maq 7mar 7mas 7mat 7mau 7mav 7maw 7max 7maz 7mb0 7mb1 7mb2 7mb3 7mb4 7mb5 7mb6 7mb7 7mb8 7mb9 7mbk 7mcj 7md7 7mfi 7mgx 7mhb 7mhv 7mhw 7mi0 7mi1 7mi2 7mia 7mic 7miw 7mk3 7ml5 7mm2 7mm3 7mm4 7mm5 7mm6 7mm7 7mm8 7mm9 7mma 7mmb 7mmc 7mmd 7mme 7mmf 7mmg 7mmh 7mmi 7mmj 7mmk 7mml 7mmn 7mmz 7mnj 7mnk 7mnl 7mnp 7mnq 7mnr 7mns 7mnt 7mnu 7mnv 7mnw 7mnx 7mny 7mnz 7mo0 7mo3 7mo4 7mo5 7mp3 7mqq 7msr 7mss 7mst 7mu5 7mu8 7mvt 7mvw 7mvx 7mw0 7mw1 7mws 7mww 7mwx 7mx5 7myj 7myx 7n09 7n10 7n1l 7n1n 7n1o 7n2b 7n3v 7n3y 7n3z 7n56 7n6p 7n6s 7n79 7n7s 7n7z 7na9 7nbv 7ncv 7ncw 7nde 7ndh 7ndi 7ndj 7ndk 7ndy 7ne0 7ne1 7nec 7nei 7nge 7nhe 7nhw 7nl3 7nl8 7nlc 7nlf 7nlg 7nlh 7nli 7nln 7nlo 7nlp 7nlr 7nls 7nlt 7nlu 7nlv 7nlw 7nlx 7nly 7nlz 7nm0 7nm6 7nmc 7nmj 7nmo 7nmr 7nmt 7nmv 7nmy 7nn1 7nn3 7nn4 7nn5 7nn7 7nn8 7nnb 7nnc 7nni 7nnq 7nnr 7not 7np5 7np6 7nph 7npi 7npj 7npp 7nqd 7nqe 7nqf 7nrg 7ns8 7ns9 7nsa 7nsd 7nsf 7nsx 7nsy 7nsz 7nt0 7nt1 7nt2 7nt3 7nts 7ntt 7ntv 7ntw 7nuk 7nwr 7ny3 7nzr 7nzs 7nzt 7nzu 7nzw 7nzx 7nzz 7o04 7o0b 7o1n 7o23 7o2m 7o55 7o61 7o6h 7o6r 7o6s 7o6t 7o6u 7o6v 7o6w 7o7u 7o7v 7o7w 7o7x 7o9f 7o9g 7o9h 7o9i 7obv 7oc2 7ocz 7odb 7odd 7odi 7odj 7odk 7ofw 7ofz 7og0 7ogo 7ogq 7ogu 7ogz 7ohd 7ohi 7okr 7oof 7opk 7oqv 7ory 7osk 7ot6 7ota 7otb 7otk 7otn 7otx 7otz 7out 7ouu 7ouv 7ov1 7ov5 7ov6 7ov9 7ovd 7ovo 7ovs 7owv 7owz 7ox7 7ox8 7ox9 7oxa 7oxq 7oxw 7oxx 7oy9 7oyi 7oys 7oyt 7oyu 7oyv 7oyw 7oyx 7oyy 7oyz 7oz2 7oz5 7ozt 7p0a 7p0e 7p0k 7p0n 7p0r 7p0t 7p0v 7p11 7p1m 7p25 7p42 7p4a 7p4j 7p4l 7p4o 7p5r 7p6r 7p6s 7p6t 7p75 7p76 7p80 7p81 7p90 7p9j 7pab 7pb6 7pb7 7pbc 7pbf 7pdq 7pdt 7pdw 7pdx 7pe0 7pef 7pfq 7pfy 7pfz 7pg1 7pg8 7pgb 7pgc 7pgg 7pgi 7pjo 7plb 7plc 7pld 7pli 7plk 7pmm 7pmq 7poa 7pob 7poc 7ppx 7pq9 7prg 7pud 7pug 7puu 7puv 7puw 7pwb 7pwh 7px1 7px4 7pxq 7pyr 7q0c 7q0d 7q0e 7q0q 7q10 7q15 7q1d 7q1m 7q1n 7q1o 7q1p 7q1x 7q3b 7q3p 7q47 7q4g 7q4x 7q5c 7q5v 7q5x 7q76 7q78 7q79 7q7a 7q7b 7q7c 7q7d 7q7e 7q7f 7q7g 7q7h 7q7j 7q7m 7q7n 7q7o 7q85 7qaz 7qb2 7qbq 7qbr 7qbz 7qc0 7qce 7qdp 7qdq 7qec 7qeh 7qfg 7qfj 7qfk 7qfl 7qfm 7qfn 7qfo 7qfy 7qgs 7qgx 7qgy 7qgz 7qhd 7qhe 7qji 7qjj 7qka 7qkb 7qkc 7qle 7qlh 7qno 7qp3 7qpj 7qpl 7qqo 7qqp 7qqq 7qqr 7qqs 7qqt 7qqu 7qqw 7qqx 7qqz 7qr0 7qr1 7qr5 7qr7 7qr8 7qsc 7qsg 7qta 7qtb 7qtm 7qu1 7qu2 7qvb 7qvh 7qvw 7qw3 7qwi 7qz1 7r1o 7r1t 7r1u 7r2g 7r2x 7r33 7r34 7r35 7r36 7r3n 7r50 7r52 7r53 7r54 7r9d 7rah 7rca 7rcr 7rct 7rdw 7re5 7reu 7rfy 7rfz 7rg0 7rg1 7rg2 7rg3 7rg4 7rg5 7rg6 7rge 7rgn 7rgs 7rgt 7rh8 7rj1 7rji 7rjz 7rkk 7rkl 7rks 7rku 7rll 7rlm 7rmd 7rn2 7roa 7rox 7rpt 7rpu 7rq8 7rq9 7rqa 7rqb 7rqc 7rqd 7rqe 7rqg 7rt7 7rur 7rus 7rva 7ry2 7ry7 7ry8 7ry9 7rya 7ryb 7ryx 7rzz 7s00 7s01 7s0k 7s0p 7s1d 7s1e 7s1f 7s1l 7s2i 7s2j 7s2k 7s2l 7s2m 7s3j 7s3l 7s3m 7s3n 7s3p 7s4e 7s5m 7s5n 7s5o 7s6b 7s6e 7s6f 7s6g 7s7s 7s86 7s8d 7s8k 7s8q 7s8s 7s8y 7s8z 7s90 7s95 7s98 7s99 7s9f 7s9g 7s9h 7s9i 7sbi 7sbj 7sdp 7sgc 7shq 7sir 7sj3 7skb 7skq 7snk 7sno 7snu 7soz 7spd 7spm 7spn 7spr 7ssf 7ssu 7suc 7sut 7sv9 7svb 7svx 7sx5 7sxe 7sy9 7sz2 7sz3 7szp 7szu 7szx 7szy 7t00 7t0r 7t0y 7t1w 7t1x 7t35 7t3e 7t3x 7t5c 7t5d 7t5e 7t5y 7t69 7t6a 7t6c 7t6h 7t70 7t7a 7t7i 7t7j 7t7t 7t8j 7t8m 7t8r 7t8w 7t9w 7t9y 7ta4 7ta7 7tb2 7tbr 7tbt 7tbu 7tbv 7tc4 7tc6 7tcm 7tcy 7td5 7tdy 7te5 7tgp 7tgs 7tgt 7tgu 7tgv 7th1 7th6 7th7 7thb 7thc 7thd 7thf 7thg 7ti7 7ti9 7tj1 7tjl 7tkv 7tlm 7tlp 7tlq 7tlr 7tmu 7tn1 7tnv 7tog 7toh 7toi 7toj 7tok 7tq1 7trv 7tsw 7tt9 7tua 7tvj 7twc 7twe 7twg 7twh 7twi 7twj 7twn 7two 7twp 7twq 7twr 7tws 7twt 7twv 7tww 7twx 7twy 7tx0 7tx1 7tx3 7tx4 7tx5 7tx9 7txm 7txn 7txo 7tyg 7tzj 7tzr 7tzs 7tzt 7tzu 7u0y 7u1h 7u1i 7u1j 7u2h 7u2i 7u2j 7u4c 7u4h 7u4o 7u4r 7u4w 7u4z 7u56 7u5f 7u5q 7u5y 7u6k 7u6l 7u7o 7u8y 7u98 7u99 7u9a 7ubu 7uc5 7ucc 7ucd 7udj 7udk 7udl 7udm 7udn 7udo 7uf8 7ufx 7ug3 7ug8 7ugw 7ui3 7uie 7ulh 7ulz 7um8 7uma 7umu 7umv 7umw 7umx 7umy 7un0 7un4 7uo3 7uof 7uog 7up5 7up8 7upo 7upp 7upq 7ur0 7url 7us1 7utt 7uuj 7uuk 7uul 7uum 7uun 7uuo 7uux 7uv6 7uv7 7uxg 7uxw 7uxy 7uy2 7uyi 7uyq 7uyz 7uzr 7uzt 7v09 7v0c 7v0h 7v0r 7v1t 7v3q 7v58 7v5i 7v64 7v7k 7v8q 7v8y 7v8z 7va8 7vaa 7vac 7vaz 7vb3 7vb5 7vb6 7vbt 7vbu 7vbv 7vbx 7vc6 7vdn 7vft 7vhc 7vhd 7vhe 7vhf 7vin 7vio 7vip 7viq 7vir 7vis 7vit 7viu 7vjl 7vlm 7vnb 7vpw 7vq6 7vr6 7vrf 7vru 7vs4 7vso 7vt9 7vtj 7vuf 7vuk 7vvi 7w1g 7w1s 7w2s 7w2t 7w2v 7w2w 7w2x 7w5d 7w5q 7w5r 7w74 7w7x 7w7y 7w89 7w8d 7wag 7wbg 7wbi 7wc0 7wcs 7wej 7wew 7wi7 7wja 7wjb 7wjc 7wjd 7wje 7wjf 7wjt 7wkj 7wls 7wlv 7wrw 7wrx 7wwq 7wwz 7wx2 7wxj 7wxk 7wxl 7wxm 7wxn 7wxo 7wxp 7wxq 7wxr 7wyr 7wzu 7x09 7x20 7x5n 7x5o 7x63 7x77 7x7o 7x9g 7xaf 7xf3 7xgb 7xgk 7xgo 7xgp 7xhr 7xhs 7xif 7xig 7xih 7xii 7xik 7xil 7xkg 7xlj 7xm2 7xm3 7xm4 7xm5 7xot 7xqt 7xqu 7xte 7xtf 7xtl 7xtm 7xtn 7xuy 7xws 7y16 7y17 7y18 7yav 7ycb 7ycd 7ycf 7yct 7ycv 7ygh 7ygk 7ygl 7ygv 7ygw 7ygy 7yh8 7yhj 7yhl 7yib 7ylk 7yny 7yq2 7yq7 7yvz 7yw7 7yw8 7yxt 7yzx 7z0k 7z0n 7z1f 7z1g 7z1i 7z1p 7z1q 7z1r 7z1s 7z2l 7z36 7z3k 7z3l 7z3t 7z3u 7z53 7z58 7z5g 7z5h 7z68 7z6m 7z6n 7z6o 7z6t 7z6u 7z7e 7zau 7zba 7zbb 7zbd 7zbg 7zgh 7zgm 7zgn 7zh8 7zhk 7ziu 7zku 7zlc 7zld 7zlm 7zln 7zlo 7zlp 7zlr 7zls 7zmi 7zmu 7zmw 7zno 7znr 7zns 7zoc 7zor 7zpb 7zpc 7zpd 7zq1 7zqf 7zsz 7ztm 7zu8 7zug 7zum 7zus 7zv0 7zv4 7zv9 7zva 7zvb 7zvc 7zvk 7zvv 7zw5 7zwk 7zwl 7zx0 7zx1 7zx3 7zx9 7zxa 7zxb 7zxv 7zxz 7zys 8a0a 8a15 8a16 8a17 8a1b 8a1c 8a1f 8a1i 8a23 8a2x 8a38 8a3q 8a4n 8a4u 8a4v 8a4w 8a4x 8a53 8a56 8a5r 8a5s 8a5x 8a6x 8aa9 8aaj 8aas 8ab2 8ae9 8aen 8aep 8aev 8afi 8afr 8agg 8agh 8agm 8agn 8ago 8agp 8ags 8agy 8ah0 8ah1 8ah3 8aha 8ahb 8ahd 8ahg 8ahh 8ahi 8ai7 8ak2 8ak3 8alk 8alu 8am1 8am2 8am3 8am6 8am8 8amr 8ams 8aol 8aon 8aq8 8aqa 8aqb 8aqg 8aqk 8aqp 8asm 8aso 8asz 8at0 8auu 8avk 8avl 8avm 8avn 8avr 8avs 8avt 8avu 8axc 8azc 8azd 8azi 8azl 8azm 8azn 8azo 8azp 8b07 8b1n 8b2i 8b2k 8b34 8b3c 8b3k 8b3n 8b3r 8b3y 8b4q 8b5p 8b66 8b9n 8b9x 8ba5 8bae 8baf 8bag 8bao 8bb7 8bbp 8bbt 8bcl 8bdd 8bdq 8bdw 8bf1 8bf2 8bf3 8bf4 8bfc 8bff 8bgj 8bgn 8bgo 8bgp 8bi7 8bjg 8bjl 8bjn 8bjo 8bjr 8bjy 8blj 8blx 8blz 8bm5 8bn2 8bn5 8bny 8boq 8bos 8bpt 8br4 8bra 8brb 8bry 8brz 8bs0 8bs1 8bs2 8bs3 8bs9 8bsa 8bsb 8bt3 8bt4 8bty 8bu1 8bu2 8bu3 8bu4 8bu5 8bu6 8bu7 8bu9 8bua 8bub 8buc 8bud 8bue 8buf 8bug 8buh 8bui 8buj 8buk 8bul 8bum 8bun 8buo 8bup 8buq 8bur 8bus 8but 8bv1 8bv8 8bwg 8bwk 8bwu 8bxz 8by1 8byh 8bzk 8bzl 8bzp 8c0m 8c12 8c2e 8c2f 8c2g 8c3c 8c3x 8c3z 8c40 8c42 8c43 8c46 8c4a 8c51 8c5h 8c5k 8c5l 8c5m 8c5n 8c73 8c76 8c7p 8c8u 8c8v 8c8w 8c9d 8c9e 8c9f 8c9g 8c9i 8c9s 8car 8cav 8cb2 8cbx 8cby 8cbz 8cc0 8cc1 8ccw 8ccz 8ceq 8cer 8ces 8cet 8cev 8cgb 8cgo 8cha 8cil 8cj1 8cj2 8cj3 8cjd 8cje 8cjf 8cjg 8ckg 8ckk 8ckl 8ckm 8ckn 8cm8 8cn3 8cnf 8cnn 8cnp 8coi 8cqm 8crc 8crg 8cso 8ctp 8ctq 8cvj 8cvk 8cvl 8cwp 8cxf 8cyf 8d1u 8d1x 8d2z 8d35 8d3e 8d3g 8d3h 8d3i 8d3j 8d3k 8d3n 8d3o 8d57 8d5g 8d5h 8d5i 8d78 8d79 8d7f 8d86 8d8m 8day 8daz 8db0 8db1 8dcc 8dcm 8dcn 8dei 8deo 8dfg 8dfh 8dfi 8dgm 8dgn 8dgo 8dgp 8dhc 8dhy 8div 8diw 8dix 8diy 8diz 8dj0 8dj1 8dlc 8dld 8dni 8dnj 8dnk 8dox 8doy 8dp9 8dpa 8dpr 8dqt 8dsu 8dt9 8dtq 8dvc 8dvp 8dvy 8dw0 8dw4 8dw7 8dyz 8dz7 8e15 8e1b 8e1c 8e1f 8e1g 8e1p 8e2n 8e5c 8e5s 8e5v 8e60 8e6h 8e6i 8e6l 8e6m 8e6n 8e7f 8eae 8eaz 8eb0 8eb2 8eb5 8ebc 8ebo 8ecc 8ed6 8eda 8edc 8edi 8edk 8edp 8ee2 8efz 8egk 8egn 8ehh 8ehu 8ejm 8eju 8ejv 8ek9 8ekb 8ekf 8ekx 8el0 8el1 8el3 8el4 8el5 8el6 8elf 8eln 8eme 8enb 8end 8eo5 8eo6 8eo7 8eoh 8ep4 8eq8 8eqh 8etb 8ev6 8ev7 8evd 8ew1 8ew8 8ew9 8ewa 8ewh 8ewo 8exe 8exf 8eyu 8eyv 8eyw 8ezr 8ezs 8ezt 8f09 8f0n 8f1h 8f1s 8f1v 8f1w 8f1x 8f1y 8f1z 8f20 8f23 8f2q 8f2w 8f2y 8f3k 8f69 8f6b 8f6u 8f6v 8f7f 8f7g 8f7h 8f7i 8f7n 8f7o 8f7p 8fbx 8fc1 8fc2 8fc3 8fc4 8fc5 8fc6 8fd9 8fdp 8fe6 8fe7 8fe9 8feb 8ff0 8fg5 8fg7 8fhv 8fhx 8fhz 8fi0 8fi1 8fi2 8fi7 8fi8 8fii 8fij 8fik 8fil 8fim 8fj8 8fl5 8fm6 8fmc 8fmd 8fme 8fn3 8fny 8fo0 8fo6 8fog 8fol 8foq 8for 8fos 8fqq 8fqr 8fqs 8fqt 8fqu 8fr9 8fra 8frb 8frc 8frd 8frg 8fsi 8ft6 8ft8 8ftj 8ftq 8ftt 8fua 8fub 8fuc 8fuf 8fuh 8fuq 8fvx 8fwl 8fy6 8fy7 8fz3 8fz4 8fza 8fzm 8fzu 8fzv 8fzz 8g10 8g1j 8g23 8g29 8g2a 8g2b 8g2c 8g2d 8g2n 8g32 8g33 8g4j 8g6d 8g7w 8g7x 8g8h 8g8j 8g95 8g96 8g97 8g98 8gai 8gb1 8gb2 8gb4 8gbb 8gbf 8gbk 8gca 8gex 8gi3 8gi6 8gia 8gid 8gie 8gif 8gil 8gim 8gin 8gio 8gip 8gir 8gis 8git 8gjb 8gk3 8gm3 8gm4 8gm5 8gmb 8gml 8gn0 8gn1 8gnn 8gpc 8gpd 8gpe 8gqq 8grt 8gsj 8gth 8gun 8guo 8gup 8gxl 8gxm 8gxn 8gxo 8gxv 8gy4 8gy9 8gya 8gyb 8gyd 8h0s 8h0t 8h1a 8h1b 8h1e 8h1f 8h1g 8h26 8h27 8h5t 8h5u 8h7b 8h7f 8h7h 8h8i 8h8p 8hac 8had 8hbt 8hcj 8hfp 8hgv 8hgw 8hi5 8hi6 8hja 8hlo 8hm1 8hm2 8hmm 8hmq 8hmr 8hms 8hmu 8hnt 8hnw 8ho4 8ho5 8hpj 8hpk 8hpp 8hpz 8hq9 8hqa 8hqu 8hrf 8hrh 8hs7 8htw 8hu6 8hub 8huc 8hy5 8i5c 8i5d 8i5e 8i5o 8i5p 8i5q 8i5r 8i5s 8i5t 8i5u 8i6l 8i77 8i7l 8i7q 8i81 8i8f 8i8j 8i8k 8i8l 8i8m 8i8n 8i8o 8i8q 8i8u 8iag 8iey 8if0 8ifx 8igt 8ih4 8ijo 8ijp 8ik4 8ik8 8ikd 8il4 8il5 8il7 8il8 8in9 8iqa 8iqb 8iqc 8iqd 8iso 8isp 8isq 8isr 8iu7 8ivd 8ivu 8ix8 8ixx 8iy4 8j0a 8j0u 8j0v 8j0w 8j0x 8j0y 8j0z 8j10 8j11 8j16 8j2q 8j4c 8j59 8j5w 8j5x 8j61 8j63 8j64 8j67 8j6y 8j82 8j9c 8j9d 8j9t 8jae 8jbb 8jbc 8jbo 8jcq 8jcr 8jcs 8jf3 8jfb 8jgd 8jh1 8jhl 8joz 8jsc 8juk 8jw3 8jwy 8jwz 8jx6 8k1r 8k4r 8k5m 8kb6 8kg3 8kh2 8oe3 8oe9 8oea 8oeb 8oec 8oex 8oez 8oiv 8oj1 8oj2 8ok3 8ok4 8ok5 8ok7 8ok8 8okh 8oku 8onh 8oom 8op0 8opi 8opu 8opv 8opw 8opx 8opy 8oql 8oqm 8oqn 8oqo 8oqp 8oqq 8oqr 8oqs 8oqt 8oqu 8oqv 8orv 8orw 8osv 8osx 8osz 8ot0 8ot2 8oto 8otr 8ou1 8ov0 8ov1 8ov2 8ov3 8ov4 8ovs 8ovt 8ovv 8owt 8owv 8oww 8owx 8owy 8oxv 8oxw 8oxx 8oxy 8oz2 8p0c 8p0e 8p44 8p45 8p4l 8p6o 8p6q 8p7a 8p88 8p89 8pc3 8pc8 8pcx 8pdt 8pe3 8ped 8pf8 8pii 8pku 8pkv 8pkw 8pkx 8pp3 8pp4 8pp8 8pp9 8ppa 8ppb 8ppc 8ppd 8ppe 8ppf 8ppg 8pph 8ppi 8ppj 8pps 8pqn 8pwz 8pz3 8q3y 8q3z 8q40 8q41 8q42 8q43 8q44 8q52 8q5j 8q8k 8qaw 8qax 8qay 8qfe 8qff 8qfg 8qfh 8qfi 8qfj 8qh6 8qmk 8qml 8qq1 8qq5 8qq7 8qre 8qu2 8qu3 8qua 8qxw 8qxx 8qzg 8r10 8r18 8r1n 8r1p 8r1t 8r43 8r67 8r8n 8r8o 8rbi 8rdp 8rdq 8rdr 8rds 8rdt 8rge 8rgs 8rgw 8rgy 8ri0 8rke 8rkf 8rkg 8rkh 8rki 8rmw 8rp3 8rp4 8rp5 8rvk 8s3x 8s8w 8s8x 8s93 8s9f 8scd 8sdb 8sdc 8sdd 8sh6 8sh8 8shk 8shu 8shy 8shz 8si0 8sip 8sj0 8sj1 8sj2 8sj7 8sj8 8sj9 8ski 8skt 8snf 8snk 8sp2 8spc 8ssk 8sud 8svc 8svg 8svh 8svi 8svj 8sxs 8sy2 8sy3 8sy8 8szy 8t1q 8t1r 8t1y 8t1z 8t24 8t26 8t27 8t2d 8t5g 8t5m 8t5r 8t5x 8t7j 8t8b 8t8c 8tca 8tha 8tip 8tiq 8tir 8tis 8tit 8tiu 8tiv 8tiw 8tix 8tiy 8tiz 8tj0 8tj1 8tjl 8tn1 8tn6 8tnb 8tnc 8tnd 8toq 8tor 8tos 8tot 8tou 8ttk 8tuq 8tur 8tus 8tut 8tuu 8tuv 8tv6 8tv7 8twq 8tzu 8u0o 8u0p 8u0x 8u1e 8uac 8ud6 8ud7 8ud8 8ujt 8ujv 8ujx 8uk4 8uk7 8use 8usf 8usg 8ush 8usi 8usj 8usk 8usl 8uub 8ux7 8v2y 8vev 8vfu 8w1n 8w7d 8w7h 8w7n 8wdt 8wte 8wu8 8wul 8xa9 8xe7 8xep 8xfd 8xj0 8y1j 8y2s 8y9x 8yg2 8yhr 8ysa 8yt5 9azx 9emj 9eml 9emv 9eun

DAREFI

1a0s

DEMON

1dm0

DEMON-ANGEL

1aro

DENMOD

1yfg

DF

4ev2

DIFFERENCE

2pub

DIMPLE

6fba 6hl7 8b35

DJF

1hxs

DM

1a1r 1atg 1aw5 1ayf 1bko 1bs0 1bsf 1bt1 1bt2 1bte 1bug 1c8n 1cx8 1d2n 1dab 1dao 1dc0 1ddo 1dfc 1dg3 1dkr 1dov 1ebf 1eg4 1eis 1ex6 1ezv 1f2i 1f2q 1fc3 1fc4 1fcg 1fd3 1fe1 1feu 1few 1fez 1fgx 1fiy 1fj2 1flo 1fnt 1fo4 1fou 1fx7 1g12 1g64 1g6q 1g6u 1ga1 1gso 1gt7 1gyg 1hqz 1hx1 1i6w 1i9g 1id0 1igr 1igw 1iit 1iiw 1ijv 1ilx 1im8 1inl 1io0 1ips 1itw 1j1c 1j2v 1j7g 1j7v 1j85 1j8b 1j8d 1jen 1jfa 1jfl 1jg8 1jku 1jl9 1jnr 1joe 1jog 1jqk 1js3 1js6 1juh 1jvb 1jy3 1k12 1k40 1k47 1kag 1key 1kfl 1krh 1ku9 1kuv 1kv7 1l5v 1l6i 1l9l 1ln0 1lu9 1lvf 1m32 1m6n 1mjg 1mkf 1mo9 1mqt 1mw5 1n69 1nfv 1nhe 1njr 1nks 1nkz 1oqf 1ox8 1oy0 1oyr 1p22 1p3h 1p7b 1pci 1pkl 1pym 1qc6 1qd5 1qhb 1qr7 1qsa 1qsp 1qto 1qtr 1qty 1qus 1r27 1r29 1rer 1rhy 1rwi 1s1m 1sa0 1sc6 1u83 1v5y 1v5z 1vhb 1w25 1w8i 1y89 1ygs 1z5g 1ztm 2a96 2acy 2ahj 2ao7 2bgh 2bo9 2f6s 2f96 2fju 2gb0 2hrv 2i6a 2ixr 2j0o 2nwh 2o9x 2omo 2pc6 2pf5 2pz9 2q24 2qmo 2qnu 2qzv 2ush 2uwn 2v8e 2yxq 344d 3bed 3bm3 3cdh 3cni 3cnv 3dca 3dcl 3dm8 3dtv 3ea0 3ec6 3ec7 3ect 3ed5 3edp 3eef 3efb 3egl 3ehb 3elk 3eo4 3erm 3ewl 3eyt 3f0c 3f1b 3f42 3f5b 3f5r 3f67 3f6m 3f6v 3f9u 3fc7 3fes 3fet 3feu 3ff4 3ffh 3fg8 3fg9 3fgg 3fh0 3fk8 3fko 3fnb 3fpi 3fq6 3frm 3ftt 3fwz 3fz4 3fz5 3fzv 3g64 3g74 3g8w 3gby 3gdw 3gdz 3ge2 3gfv 3gjy 3gjz 3gku 3gkx 3gl5 3gn3 3gnj 3gve 3gx1 3h1n 3h1q 3h3m 3h5q 3h9p 3hbc 3hcz 3hdj 3hdt 3hfr 3hif 3hiu 3hjj 3hl0 3hlu 3hm2 3hnw 3hrl 3hsi 3hyl 3hyq 3i38 3i4p 3i8n 3i8o 3ibz 3ic6 3ic7 3ic9 3icc 3igj 3ih5 3ih6 3iii 3ikb 3ilk 3ilx 3iru 3is1 3ius 3iuv 3iv6 3ivp 3ix7 3ju1 3ju3 3ju8 3k0b 3k0l 3k3s 3k6c 3k6h 3kao 3kbr 3kdq 3kkb 3kkc 3kkd 3kmi 3knw 3kwp 3kxr 3kyz 3kzl 3kzp 3l0z 3l1w 3l5z 3l6w 3lae 3lag 3lax 3lay 3laz 3ldu 3led 3lgc 3lhe 3lhh 3lhk 3ljl 3lkl 3ll7 3lo3 3loq 3lqk 3lqy 3lsg 3lso 3lup 3lv9 3lvu 3lyd 3lzk 3m05 3m0z 3m1r 3m33 3m49 3m6j 3m6y 3m84 3mah 3maj 3mgl 3mkl 3mn2 3mnf 3mo4 3mt0 3mt1 3muq 3mvn 3mw6 3mxq 3mz1 3n04 3n2q 3n3t 3n73 3n7z 3ne8 3net 3neu 3ni7 3nja 3nkz 3nos 3nqr 3nyi 3nym 3nze 3o12 3o2i 3ocj 3ocm 3oco 3od1 3oi8 3oj0 3olo 3olq 3om8 3on3 3on4 3op4 3op9 3opc 3oqg 3os6 3ot1 3ovk 3pmm 3pn8 3pn9 3pnn 3qao 3qjo 3qom 3qoo 3qsj 3qsl 3qtd 3qwt 3qz6 3r0v 3r1x 3rao 3re2 3rht 3riv 3rmq 3rob 3rpc 3rpw 3rq0 3rxz 3s2w 3sg0 3sho 3srt 3szm 3t8k 3tng 3tov 3tp9 3ttg 3u2r 3u4y 3udo 3udu 3uwd 3v0r 3v48 3v4d 4dzr 4e4y 4e5u 4eae 4ebz 4er9 4erh 4esj 4evq 4evr 4evs 4evu 4evx 4fca 4g6q 4gb5 4gbj 4gqa 4gs5 4gxt 4gyt 4h3t 4h3v 4h7l 4hc5 4hde 4hku 4hn3 4hvm 4hx6 4hyl 4i19 4i1d 4i66 4i6v 4igv 4ikg 4ipt 4iqd 4iqn 4iyh 4j10 4jdu 4jdz 4jsb 4jvt 4jwo 4jxq 4jxr 4kia 4kq9 4kt7 4ktb 4kv7 4kvf 4l3b 4ljs 4llc 4lpq 4lzk 4m0g 4m0m 4m3s 4m7o 4m9u 4mk6 4ml9 4mnr 4mnu 4mo9 4mpt 4mv2 4mve 4my0 4my3 4nas 4neg 4nmu 4nmw 4nmy 4noc 4np6 4npb 4nqr 4o5a 4o9i 4od5 4olk 4oq2 4oqj 4psu 4pva 4pys 4pz0 4pzl 4q2b 4q31 4q63 4q6j 4q6t 4q6w 4q7a 4q7o 4q7q 4q82 4qn8 4r0j 4r5q 4r7q 4r82 4r9x 4rck 4rd7 4rd8 4rgi 4rgk 4rgr 4rgs 4rgu 4rgx 4rn7 4rnl 4rv5 4rwe 4rxi 4rxv 4rye 4s17 4s1n 4tmk 4tx9 4v4k 4v5o 4v60 4v7r 4xea 5xhc 5xi7 6mr3 7p7i 9gaa 9gac 9gaf

DMMulti

1dle 1dqs 1epu 1itw 1mjg 4v7r 7c4d

DPHASE

1a28 1tfe

EDEN

1l9a

EDPDB

3orc 6cro

ELVES

1mru 3k7z

ENVAT

1dqs

ENVELOPE

1c8d 1c8e 1c8f 1c8g 1c8h 1m06 1na1 1rvf 1s58

ESSENS

1fpp

FASTRAN

6csc

FFFEAR

1jl4 1o0v 4a7p 4v7g

FFT

1c3j 1f63 1f65 1g49 1hy7 1idq 1idu 1mj3 1pkl 1tv8 2fb2 2fb3 2pvq 3g5h 3gus 3ie3 3lsh 3lsi 3lsk 3lsm 3s4g 3uri 3urj 3url 4ict 4ips 4ipw 4iq7 4iq9 4lp9

FFTBIG

2dr6 2drd

FRFSUM

1bu6 1glf

FRODO

1cob 1hri 1ia1 1ia2 1ia3 1ia4 1iwt 1m78 1m79 1m7a 1nap 1ned 1nsa 1rnc 1sip 1ssc 3pmg 3tmn 4g6u 5jex 5jey 5jez 5jf0 5jf1 5jf2 5jf3 5jf4 5jf5 5jf6 5jf7 5jf8

FROFFT

4bir

GAP

1opo

GETAX

1nks

GROPAT

1a87

HASSP

1aui 1av1 1dqs

HEAVY

1a34 1aui 1ayf 1b47 1bqg 1cbu 1efv 1qcx 3kar

HELICAP

3opc 4dim

HKL2Map

2gb9 3alp 3d59 3k66 3kmh 3ls7 3lwt 3lzy 3m3d 3p4a 3p4c 3p5p 3pa6 3rcp 3rft 3swb 3tix 3vc1 4gjw 4heo 4o32 4ohv 4pnc 4psn 4qjh 4qlm 4rhi 7pk2

HYSS/RESOLVE

3f31

ILMILIONE

3n30 3n32 4g9l 4ja1 4qot

ILMLIONE

4dpe

INTERPOLATE

1a34

ISAS

1hrk 1l7l 2bn2

ISAS2001

1lpl 1tov

ISIRAS

1ad3 1na6

ISOLDE

8ts7 8ts8 8ts9 8tsa 8tsb 8tsc 8tsd

ISOMORPHOUS

1ag1

Il

2z4u 3le7

IlMilione

2qes 2qet

Insight II

1c1n 1c1o 1c1p 1c1q 1c1r 1c1s 1c1t 1c1u 1c1v 1c1w 1c2d 1c2e 1c2f 1c2g 1c2h 1c2i 1c2j 1c2k 1c2l 1c2m 1c5l 1c5m 1c5n 1c5o 1c5p 1c5q 1c5r 1c5s 1c5t 1c5u 1c5v 1c5w 1c5x 1c5y 1c5z

LAFIRE

2zxu 3a7v 3a7w 3a7x 3a7y 3a7z 3a80 3a81 3a82 3a83 3a84 3a85 3a86 3a87 3a88 3a89 3a8a 3a8b 3a8c 3a8d

LATLINE

1fqy

LOCAL

1aoi 1crx

LOCHVAT

1byl

LYNN

4bcl 5cro

MAD

386d

MAD-SIR

1gid

MADIRA

2crk

MADLSQ

1scf 376d

MADPHSREF

1b3q

MADPRB

1c52

MAGICSQUASH

1n45

MAIN

1a4u 1aut 1b14 1b15 1b16 1b2l 1itv 1k32 1kfx 1p3y 1pbh 2pbh 3dca 3pbh 8pch

MAMA

1bkn 1bmo 1qhu

MAVE

1qhu

MFT

1ilc

MGR

1cd3

MICE

1d2r

MIR

1crk

MIRAS

437d

MIRPHS

1dju 1ehd

MLPHARE

4b4p 5xup

MOLEMAN2

2fxo 3lm9

MOLREP

4b6d 4fpq 4toq 4trw 4try 4trz 4tww 4twy 4twz 4ubs 4v5v 4w94 4wu5 4wu7 4wxk 4wxl 4wy3 4xq6 4xsk 4xsp 4xsr 4xsu 4ylw 4ypj 4z9j 5b3k 5b3l 5b52 5b6h 5brr 5c5n 5c5o 5cg6 5chi 5cix 5cwe 5e1u 5e93 5ea9 5eph 5f1f 5gge 5goo 5gop 5goq 5gor 5gpi 5gx6 5gx7 5gx8 5h3e 5h3f 5h6v 5j3r 5jyy 5wzm 5x4t 5x4u 5x4v 5x79 5xm7 5xs8 5xwb 5y19 5y1h 5y1k 5y1q 5y1r 5y1s 5y1t 5y1v 5y1w 5y1x 5y3i 5yoh 5yoi 5ypd 5ypj 5znx 6ejx 6er1 7anq

MRC

2yn9 3ixz 4bgn 4ux1 4ux2

MRCHK

1b5m 1f4a 1f4h 1hw6 1jqz 1jt3 1jt4 1jt5 1jt7 1jtc

MRX

1jb9

MTF/ULTIMA

1ljm

MULTIPLE

1bmf

MoRDa

6et6

Mol

4rlq 4rm3 4rmn

MolProbity

1vjk 1vk1 1xx7 1ycy 2a31 2a32 2a4k 2h0v 2h16 2h17 2h1t 2h2w 2h56 2h6x 2h6y 2h6z 2h70 2h71 2h72 2h73 2h74 2h75 2h76 2h9f 2hag 2hbo 2hbw 2hcf 2hdo 2heh 2hei 2hh6 2hhz 2hi0 2hkv 2hlj 2hlz 2hoe 2hq7 2hq9 2hr2 2hsb 2hsz 2htd 2hti 2huh 2huj 2hx1 2hx5 2hxv 2hyt 2i02 2i51 2i5i 2i6g 2i7q 2i8d 2i9w 2ia7 2iab 2iay 2icg 2ich 2ifx 2ig6 2ig7 2iiu 2iiz 2ija 2il1 2inb 2isb 2it9 2itb 2nlv 2nuj 2nvm 2nvn 2nwv 2nyh 2nzt 2o08 2o1q 2o2g 2o2x 2o2z 2o3l 2o4t 2o52 2o5r 2o62 2o7t 2o8q 2oa2 2oaf 2obn 2obp 2oc5 2oc6 2ocb 2od4 2od5 2od6 2ogi 2oh1 2oh3 2oik 2okc 2okf 2olt 2onf 2ooc 2ooj 2ook 2op5 2opk 2opl 2oqm 2ord 2osd 2oso 2otm 2ou3 2ou5 2ou6 2ouw 2own 2owp 2oyo 2ozg 2ozh 2ozj 2p10 2p11 2p1a 2p2s 2p4g 2p4o 2p57 2p7h 2p7i 2p8g 2p8i 2p8j 2p97 2pbl 2pc1 2peb 2pfr 2pfw 2pfx 2pg3 2pg4 2pgc 2pim 2pke 2pn1 2pn2 2pnk 2ppv 2pq7 2pr7 2prr 2prv 2prx 2pv4 2pv7 2pwn 2py6 2pyq 2pyt 2pyx 2q02 2q03 2q04 2q0t 2q0y 2q14 2q22 2q30 2q3l 2q78 2q7b 2q7s 2q7x 2q83 2q8n 2q8u 2q9k 2q9r 2qck 2qcv 2qdr 2qe6 2qe8 2qe9 2qea 2qec 2qeu 2qez 2qg3 2qhp 2qiw 2qj8 2qjv 2qjw 2ql8 2qml 2qmq 2qne 2qnl 2qpx 2qr6 2qs7 2qtd 2qtp 2qtq 2qvp 2qw5 2qww 2qwz 2qyc 2qyv 2qzc 2r01 2r0x 2r11 2r1i 2r3b 2r3e 2r3s 2r44 2r4i 2r6v 2r7h 2r9v 2ra9 2raa 2raf 2ras 2rau 2rb7 2rbd 2rcc 2rcd 2rd9 2rdc 2re2 2re3 2re7 2rff 2rfr 2rgq 2rh0 2rha 2rhm 2rij 2ril 2rkh 2rld 3b2y 3b5e 3b5o 3b5p 3b5q 3b77 3b7c 3b7f 3b81 3b8l 3b9t 3ba3 3bb5 3bb9 3bbj 3bby 3bcw 3bdd 3bde 3bdi 3bdv 3bem 3bf4 3bf5 3bfm 3bgu 3bhn 3bhq 3bja 3bjq 3bjr 3bkw 3bkx 3bl4 3bln 3blz 3bm7 3bn7 3bn8 3bo9 3bor 3bos 3bwv 3bww 3bwx 3bxp 3by7 3byq 3c18 3c1a 3c1l 3c24 3c26 3c3p 3c5y 3c6c 3c8l 3c8u 3c8v 3c8w 3cbu 3cc1 3cc8 3ccf 3ccg 3ce8 3ce9 3cea 3ceb 3cec 3cgg 3cgh 3cgx 3ch0 3chv 3cin 3cjd 3cje 3cjl 3cjm 3cjx 3cjy 3ck1 3clm 3clo 3cm1 3cmb 3cnh 3cnx 3cny 3cpx 3csv 3csw 3ct8 3ct9 3cu2 3cu3 3cuc 3cvj 3cvo 3cwr 3d00 3d02 3d1c 3d2l 3d33 3d4e 3d4o 3d4r 3d5p 3d7i 3d7q 3d82 3d8p 3d9r 3dao 3dax 3db0 3db2 3db7 3dcf 3dcx 3dcz 3ddd 3dde 3ddj 3dee 3dfe 3dfu 3di4 3di5 3djm 3dka 3dkq 3dl1 3dlc 3dmb 3dmc 3do5 3do6 3dtt 3due 3duk 3dv8 3dwd 3dxo 3dxp 3dxq 3dz8 3dza 3dzv 3dzz 3e02 3e0f 3e0z 3e10 3e11 3e38 3e39 3e49 3e4v 3e5d 3e8o 3e8s 3e97 3e98 3e99 3eap 3ebr 3ebt 3eby 3ec4 3ec9 3ecf 3edo 3ef8 3ege 3egq 3egr 3ehc 3ejk 3ejn 3ejv 3ek3 3ele 3elg 3en8 3eo6 3eo7 3eo8 3eof 3eqx 3er7 3es1 3es4 3etn 3eu8 3eua 3euc 3ez0 3ez1 3ezs 3ezu 3f0h 3f14 3f1z 3f2r 3f40 3f43 3f44 3f6t 3f7c 3f7s 3f7w 3f7x 3f8h 3f8x 3f9s 3f9t 3fa5 3fcn 3fcr 3fd0 3fdb 3fdh 3fez 3ff0 3ff2 3ffr 3fge 3fgv 3fgy 3fh1 3fj1 3fj2 3fjs 3fjv 3fka 3fkh 3fkj 3fkq 3flj 3fm2 3fmb 3fmc 3fsd 3fse 3fxa 3fzq 3fzx 3g0k 3g0t 3g14 3g15 3g16 3g23 3g2g 3g3l 3g3s 3g68 3g6i 3g7p 3g7q 3g8y 3g8z 3g9x 3gag 3gb0 3gbh 3ge5 3ge6 3get 3gf6 3gf8 3gf9 3gfa 3gff 3ggd 3gi7 3giw 3gju 3gn6 3go4 3go5 3goh 3gr3 3gr4 3grd 3gs9 3gux 3gwp 3gwq 3gwr 3gxg 3gxh 3gy9 3gya 3gyc 3gyd 3gz7 3gza 3gzb 3gzi 3gzr 3gzs 3h0n 3h2d 3h3h 3h3i 3h3l 3h3z 3h41 3h4o 3h4q 3h4y 3h50 3h51 3h8u 3hba 3hbk 3hbz 3hc1 3hdu 3hdx 3hft 3hi0 3hj9 3hk4 3hl1 3hlz 3hm4 3hmz 3hn0 3hn5 3hn7 3hoi 3hrg 3hrp 3hsa 3htn 3htv 3hty 3hvy 3hwr 3hwu 3hx8 3hyn 3hzp 3i09 3i0y 3i0z 3i10 3i16 3i4g 3i7a 3i7d 3ib5 3iee 3ieh 3if2 3iht 3ihu 3ihv 3iib 3iic 3imk 3imm 3in6 3ing 3irb 3isu 3isx 3isy 3iup 3iuu 3iuw 3iuz 3iv0 3iv7 3jq0 3jq1 3jr1 3jsj 3jtw 3jtx 3ju7 3jx8 3jx9 3jys 3jzd 3jzl 3jzy 3k0y 3k0z 3k11 3k1t 3k2k 3k50 3k5j 3k69 3k6o 3k6q 3k7c 3k8r 3k93 3k9i 3k9t 3kd4 3kdw 3ke2 3ke3 3ke7 3kez 3kgw 3kgx 3kgy 3kh1 3khi 3kiz 3kk7 3kkf 3kkg 3kl7 3klb 3kny 3knz 3kog 3kop 3koq 3ks5 3ks6 3ks7 3ksp 3ksr 3kst 3ktc 3ktd 3kw0 3kwk 3kwr 3kws 3ky8 3kya 3kzs 3kzt 3l09 3l0a 3l12 3l22 3l23 3l2h 3l2n 3l39 3l5o 3lew 3lhi 3lhn 3lho 3liu 3ljy 3llc 3llx 3lm2 3lm3 3lmz 3ln3 3lot 3lou 3lov 3lub 3lul 3lur 3luu 3lwc 3lwd 3lwf 3lwj 3lws 3lwu 3lwx 3ly1 3lyc 3lyg 3lyh 3lza 3m1t 3m1u 3m5k 3m7a 3m81 3m82 3m83 3mbh 3mbj 3mc3 3mcp 3mcq 3mcr 3mcs 3mcw 3mcx 3mdo 3mdp 3mdq 3mem 3mso 3msq 3mst 3msw 3mtq 3mvu 3mw8 3mwx 3mx3 3myv 3myx 3mz2 3mzo 3n0q 3n0v 3n0w 3n0x 3n5l 3n6x 3n6y 3n6z 3n8u 3n91 3na6 3nfv 3nl9 3nnb 3nnr 3no4 3no5 3no6 3npg 3npp 3nqh 3nqi 3nqk 3nqn 3nqo 3nqp 3nra 3nrb 3nrd 3nre 3nrf 3nrg 3nuf 3nuz 3nwp 3qi7 3qkb 3qkx 3qnk 3qqm 3qqw 3qta 3qth 3qwn 3qxb 3qz4 3qzb 3r12 3r13 3r4i 3r4k 3r4r 3r67 3r8e 3r90 3rf7 3rh2 3rh3 3rh7 3rjv 3rwx 3rza 3s01 3s25 3s30 3s5q 3s5r 3s5t 3s6e 3s6f 3s7r 3s9j 3sb3 3sb4 3sbu 3sc3 3scy 3sd2 3see 3sgg 3sgh 3siy 3snk 3sno 3snx 3so5 3son 3soo 3sot 3sy6 3t0p 3t2l 3t6k 3taw 3tc8 3tc9 3td9 3tdq 3tx8 3ty1 3tyt 3tzg 3u1w 3u1x 3u21 3u22 3u6g 3u7z 3uc2 3ucg 3uch 3ue2 3uf4 3ufi 3ulh 3up6 3up9 3urz 3us4 3us5 3uws 3uwt 3v4m 4d8k 4dad 4df9 4dgu 4djn 4dn6 4dnk 4dnl 4dqa 4dsd 4dwe 4dwf 4e0e 4e2e 4e5v 4e6e 4e6f 4e6r 4e72 4e9k 4ebg 4ecf 4ecg 4ecn 4eco 4ef1 4ef2 4ei0 4eiu 4eps 4epz 4esn 4euw 4exr 4ezg 4ezi 4f0j 4f53 4f54 4f7a 4f98 4fd0 4fdw 4fdy 4fho 4fj6 4fm3 4fmr 4fmt 4fmz 4fo5 4fr9 4fs7 4fss 4fsv 4ftd 4fuu 4fvs 4fxt 4fxv 4g2a 4g5a 4gbs 4gcm 4gdz 4ghb 4ghn 4gl3 4gl6 4goq 4got 4gpv 4gt6 4gzv 4h08 4h09 4h0a 4h17 4h1x 4h3w 4h40 4h41 4h4j 4h87 4hbr 4hbs 4het 4hf7 4hfs 4hlb 4hpe 4hsp 4hw6 4hwm 4hxc 4hyz 4i17 4i8i 4i95 4iab 4iaj 4ib2 4ici 4id2 4iej 4ipb 4irt 4is2 4is3 4ive 4iyj 4iyk 4j5o 4j8p 4j8q 4jg5 4jgl 4jhy 4jja 4jm1 4jon 4jpq 4jqr 4jqs 4jqt 4jrf 4jrl 4jx0 4jx2 4k05 4k3f 4k4k 4k61 4kh8 4kh9 4kq7 4kqt 4kw2 4kwy 4l1n 4l3r 4l3u 4l7a 4l8j 4l8k 4l8n 4l8o 4l8p 4lb8 4lba 4lda 4leh 4ler 4lg3 4lgc 4lgq 4lhs 4lii 4lij 4lir 4ljx 4lqx 4lqz 4lr4 4m0h 4m0n 4m8k 4m8r 4mcj 4mdw 4me8 4me9 4mjf 4mjg 4mjx 4mru 4mu9 4mud 4mxn 4mxt 4myr 4n0p 4n0r 4n3v 4nkp 4nrd 4ntl 4nw4 4nzj 4nzk 4o2t 4obi 4obm 4ogz 4oh1 4oju 4ole 4onz 4oo3 4opm 4opw 4orl 4ote 4ouq 4poi 4ppy 4pqx 4ps6 4puc 4pux 4pw1 4pwu 4pxy 4q0y 4q1v 4q1z 4q20 4q34 4q53 4q5k 4q5t 4q68 4q69 4q6k 4q98 4q9a 4qan 4qb7 4qdg 4qdy 4qe0 4qey 4qfu 4qgp 4qhb 4qhw 4qhx 4qhz 4qjr 4qk4 4qni 4qoa 4qpv 4qrj 4qrk 4qrl 4qt9 4qu6 4qu7 4qvu 4qy7 4r03 4r0k 4r1k 4r1l 4r1m 4r4g 4r4k 4r5o 4r7f 4r7s 4r8o 4raa 4rbo 4rdb 4rdu 4rgl 4rho 4rn3 4ru2 4rvn 4rvo 4rwv 6ff1 6ff2 6g61 6g62 6hze 6hzg 6nr0 6z8l 6zbn 6zbo 7oxw 7oxx 7poa 7pob 7poc 7q5v 7q5x 7qfn 7qfo 7wls 7wlv 7z0n 7z3k 7z3l 7z5g 7z5h 7zau 7zbg 7zgm 7zgn 7znr 7zns 8ah3 8avm 8avn 8c46

Moppre

3mwt

MrBUMP

5anp

MrBump/Molrep

4itk

N/NA

2a0b

NANtMRF

3knw

NCSMASK

1vhb

NCSREF

2oa9 2odh 2odi

Not

1sij

O

1atg 1b14 1b15 1b16 1b2l 1bdx 1c04 1c47 1c4g 1c9h 1cc0 1cjs 1cqt 1dv4 1ffz 1fg0 1g3m 1ghd 1ghe 1h0h 1hrv 1hvu 1i36 1iho 1ijx 1j48 1j4j 1jgo 1jgp 1jgq 1knv 1kxj 1l1f 1njn 1njo 1nt9 1pqv 1qd7 1qtj 1r5t 1ruc 1rud 1ruf 1rug 1ruh 1rui 1ruj 1sgu 1sh9 1szi 1u5k 1vs1 1xv2 1ylx 1yxy 1z3n 1z6m 1z72 1z77 1zdr 1zs7 1zwy 1zx5 2a14 2a31 2a32 2ad1 2aee 2ahr 2aif 2aqw 2ark 2au5 2av9 2azp 2b71 2be3 2dg2 2f06 2f6s 2f96 2fdo 2fdr 2fg1 2fgc 2fyw 2g03 2g17 2g3a 2g3b 2g7u 2g7z 2g8y 2gau 2gfq 2gs8 2gwn 2hiy 2hjs 2hr3 2i6d 2i6x 2i7g 2i8e 2i9c 2ia2 2iaf 2iai 2id3 2idl 2if7 2ijl 2itf 2np3 2np5 2npn 2nqw 2nrk 2nzc 2o0y 2o35 2o9x 2oai 2ocz 2ofy 2oiw 2ojh 2ozv 2p3h 2p3p 2p4p 2paq 2pc6 2pd0 2pfs 2pli 2ppx 2pz9 2qm0 2qm3 2qmo 2qru 2qsb 2qsi 2qx2 2r4q 2r5f 2r8d 2rbc 2rd7 2rdp 2veo 2ypn 3b85 3b8b 3bqy 3bs3 3bv8 3ced 3cex 3ci6 3cit 3cw1 3d0f 3dci 3ddh 3dew 3efg 3eh7 3f3k 3fd3 3fdj 3fgx 3fn2 3fna 3fnc 3fx3 3g27 3h35 3h36 3he0 3hea 3hfr 3hh1 3ia2 3ic3 3iii 3ijm 3iqt 3iv3 3jtf 3jw4 3k13 3k2v 3m1g 3m3x 3m4r 3m5e 3m92 3m9c 3mcz 3mfd 3mhi 3mhl 3mhm 3mho 3nbm 3owc 3peb 3pf6 3pmg 3quf 3qvo 3rpd 3rpj 3soy 3t6o 3tx6 3tzt 3u0h 3u1d 3u24 3u4g 3u7v 486d 4f8j 4fb4 4h7n 4h89 4hb7 4hbz 4hes 4hg2 4iag 4neo 4pka 4pkl 4rha 4trq 4u3f 4v42 4w5w 4wis 4wit 4xai 4xaj 4xam 4xe1 4yzf 4zca 4ztl 4ztm 4ztn 5ccd 5cce 5cdg 5cds 5cdt 5cdu 5cjp 5cvz 5cw0 5djq 5dkf 5ef5 5jaz 5jbi 5jc1 5jmp 5jmw 5jnl 5jo0 5k0h 5n9z 5oya 5vj5 5vjg 5vl0 5vn1 5ws4 6e33 6e3a 6fh1 6fv3 6oa7 6owm 6qdk 6qdl 6qdm 6yri 7kfv 7kfw 7kfx 7kfy 7qvw 7qw3 7qwi 7sn0 7sn1 7uca 7ude 7udr 7uec 7uee 7uef 7uei 7uej 8cr0 8eb5 8g39 8g41 8g4v

OASIS

1mt1 1u9s 1zr6 2cvi 2g3t 3a9f 3fha 3k6j 3wl5 4le3 4nsw

PARROT

4cz8 4d3l 5a1s 5nl9 6zhu

PATSOL

1b47

PDB-REDO

7ng2 7nh2

PERON

2dct

PHARE

1yfg

PHASE

1a8y 1bgv 1que

PHASER

2vf9 2wyi 2xot 4ph6 4pl7 4pl8 4tmb 4tmc 4tvz 4u66 4u6m 4u7p 4u7u 4v5f 4v5i 4v5o 4v8p 4v8q 4v8s 4v8u 4v90 4xlx 4xly 5a3e 5aoq 5c3n 5che 5ggx 5ggy 5i8p 5i9i 5iuh 5j4u 5jyl 5khl 5ufy 5ug1 5umj 5uzy 5v5t 5v5u 5v70 5v73 5v8d 5v8e 5xg9 5xgg 5xlu 5xsr 5xst 5xsu 5xve 5y6k 5y7w 6b30 6tor 6wc6 6ww6

PHASES-95

1an0 1cb8 1ci4 1dfc 1svy

PHASIT

1au7 1bnz 1c4d

PHENIX

1sum 1suw 1yt5 2r9p 2ra3 3a7s 3ami 3aqq 3auz 3av0 3azv 3azw 3b31 3bws 3csk 3ecr 3efc 3el6 3en0 3eni 3esl 3esq 3esr 3etf 3eur 3evp 3ey7 3ey8 3f0p 3f2f 3f2g 3f2h 3f56 3faj 3fbl 3fd5 3fd6 3fdi 3fi2 3fi3 3flo 3fm5 3fp9 3fpb 3fps 3fsg 3fso 3fv8 3fy6 3g1j 3g1w 3g51 3g6p 3g6q 3g6r 3g6t 3g6u 3g8u 3g8x 3g97 3g99 3g9i 3g9j 3g9m 3g9o 3g9p 3gbt 3gca 3gd0 3gg4 3ggr 3gh3 3gm5 3god 3gri 3grr 3gru 3grv 3gry 3gsi 3gv1 3gx2 3gx3 3gx5 3gx6 3gx7 3gyg 3gyw 3h03 3h06 3h4r 3h6a 3haj 3hgu 3hgv 3hng 3ho7 3hon 3hra 3hsh 3hsl 3htr 3hug 3hv9 3i2m 3i2v 3i3w 3i4j 3i4k 3i6e 3i86 3i9s 3ie4 3if4 3ig5 3ig8 3ihs 3imo 3inz 3ip8 3iv9 3jqh 3jsr 3jsy 3jw9 3jwa 3jwb 3jyb 3jyu 3jyy 3jyz 3jzz 3k36 3k9a 3kbo 3kd2 3kda 3kde 3kgv 3khy 3kk4 3klo 3kml 3knt 3koj 3krj 3krl 3ksu 3kts 3kx3 3kx4 3kx5 3kx8 3l08 3l1a 3l1u 3l1v 3l2z 3l4e 3l54 3l6u 3l8d 3l9t 3laj 3lbh 3lbi 3lbn 3ld2 3ld7 3lg0 3lgd 3lgg 3lj3 3lke 3llw 3ln2 3lnn 3lp6 3lq5 3lsf 3lsl 3lsw 3lsx 3lv4 3lvv 3lvw 3lvy 3lwl 3lwm 3lxf 3lxu 3m1f 3m3f 3m3k 3m3l 3m3n 3m3p 3m5w 3m66 3m7t 3m7u 3m8r 3m8s 3m9b 3m9c 3m9d 3m9e 3mbi 3mdw 3mgo 3mgt 3mip 3mis 3mix 3mmu 3mmw 3mnv 3mnw 3mnz 3mo1 3moa 3mob 3mod 3moj 3mp7 3mpu 3mq0 3mq1 3mq2 3mr7 3mtv 3mwd 3mwe 3mx1 3my1 3mya 3myc 3mye 3myu 3n14 3n1h 3n1i 3n1j 3n1k 3n1l 3n54 3na2 3nag 3nao 3nat 3nbv 3nbw 3nc2 3nc9 3nca 3nhz 3nkg 3nkj 3nm5 3nm6 3nmd 3nme 3nmu 3now 3npm 3ntj 3nvi 3nvk 3nvm 3nxl 3o1d 3o1e 3o1q 3obl 3oc2 3oet 3of5 3ogk 3ogl 3ogm 3ogt 3ogu 3oik 3oil 3oim 3ojs 3oju 3oo3 3oow 3opq 3oq0 3os8 3os9 3osa 3otv 3ou6 3oun 3out 3ox5 3oxp 3oyt 3ozq 3p06 3p09 3p0k 3p0r 3p0w 3p12 3p1l 3p4v 3p52 3p59 3p5d 3p5e 3p5f 3p5g 3p5h 3p5i 3p5p 3p5r 3p5s 3pac 3pea 3pf1 3pff 3pfi 3pi6 3pio 3pip 3pj9 3pji 3pjl 3pjn 3pjv 3pjx 3pmb 3po4 3po5 3pp8 3pp9 3pqv 3py8 3pya 3pyb 3pyi 3pzs 3q1c 3q3v 3q5d 3q5e 3q72 3q7b 3q7c 3q7m 3q7n 3q7q 3q85 3q8d 3q92 3qa2 3qai 3qb8 3qd7 3qdn 3qe3 3qfk 3qfw 3qjb 3qjc 3qjd 3qje 3qkw 3qm1 3qm3 3qml 3qmn 3qmz 3qnm 3qo2 3qqn 3qqz 3qr2 3qsv 3qwg 3qx3 3qx8 3qx9 3qyx 3r0j 3r0q 3r23 3r2p 3r2u 3r3p 3r6b 3r7c 3r8f 3r98 3r99 3rcn 3re3 3rgh 3rh4 3rh5 3rh6 3rhf 3rht 3rhz 3rj9 3rmr 3rnd 3rnm 3ro4 3rpf 3rqb 3rqu 3rqw 3rr3 3rr7 3rr8 3rrg 3rrh 3rrk 3rrl 3rrw 3rt6 3rt8 3rtf 3rtv 3rtw 3rwr 3s1z 3s20 3s23 3s2s 3s2x 3s32 3s5i 3s5k 3s5m 3s6u 3s6v 3s7l 3s7m 3s8m 3s9z 3sa0 3sad 3saz 3sb0 3sdj 3sdm 3sea 3sed 3sfj 3shs 3si7 3sid 3skl 3slr 3slu 3smv 3so2 3spw 3sqp 3srx 3srz 3ss1 3sv3 3sv4 3sw9 3swc 3sx6 3sxi 3sy4 3syi 3syn 3syz 3sz0 3sz2 3szc 3szp 3szw 3t0h 3t0k 3t14 3t1b 3t2k 3t2y 3t3f 3t4x 3t54 3t5q 3t5x 3t7a 3t7e 3t7f 3t7g 3t7h 3t82 3t83 3t84 3t85 3t93 3t96 3t97 3t99 3t9a 3t9b 3t9c 3t9d 3t9e 3t9f 3t9h 3t9u 3t9v 3t9x 3ta5 3ta7 3ta9 3tai 3tal 3tau 3taz 3tb8 3tbk 3td0 3td1 3td7 3tdw 3teg 3teh 3teq 3tfr 3tfs 3tgd 3tgn 3ti1 3tiy 3tiz 3tjq 3tjz 3tkc 3tlo 3tm8 3tmb 3tmc 3tmd 3tmm 3tmo 3tnh 3tnp 3tnq 3tnv 3toq 3tsb 3tsd 3tsn 3tsy 3tt0 3tt2 3tu9 3tuo 3tup 3tut 3tux 3tv1 3tv9 3tvy 3tw3 3ty5 3ty6 3ty8 3ty9 3tyr 3tys 3tz0 3tz2 3tz4 3tz5 3tzl 3u0r 3u1a 3u2i 3u2j 3u3i 3u48 3u4a 3u78 3u7t 3u9j 3ua3 3ua4 3ub2 3ubi 3ugb 3ugp 3uig 3uih 3uii 3uij 3uik 3uit 3uiu 3ujt 3uki 3ung 3unj 3unk 3unz 3uo4 3uo5 3uo6 3uod 3uoh 3uoj 3uok 3uol 3up2 3up7 3uq0 3uq2 3uqc 3ur3 3uu7 3uua 3uuc 3uud 3uxn 3v1v 3v1x 3v32 3v42 3v4n 3v4x 3v4y 3v6l 3v6m 3v75 3v7j 3vad 3vay 3vc2 3vcx 3vdi 3vdm 3vdn 3vdy 3ve7 3ve9 3vfd 3vhl 3vis 3vm7 3vpi 3vpv 3vrs 3vsp 3vw5 3vz9 3vza 3w03 3w0d 3w0e 3w1e 3w2e 3w2f 3w2g 3w2h 3w2i 3w31 3w4o 3w4p 3w4q 3w5k 3w6j 3w6k 3w6q 3w6w 3w6x 3w9t 3wa5 3wcr 3we1 3we8 3wee 3weu 3wfn 3wit 3wkf 3wkg 3wkh 3wki 3wkw 3wkx 3wlu 3wmh 3wo5 3wp9 3wpt 3wpw 3wpx 3wr5 3wre 3wru 3wu3 3wu5 3wu6 3wuq 3wur 3wut 3wuu 3wuv 3wvf 3ww0 3wws 3wwv 3wz3 3wz4 3wz5 3x0v 3x1l 3x2n 3x2u 3x2v 3x2w 3x2x 3x30 4bxd 4bxe 4chx 4cvi 4dbd 4dbe 4dbl 4dck 4dd5 4de4 4ded 4df0 4df1 4df4 4df8 4dfb 4dfj 4dfk 4dfm 4dfp 4dgw 4dkk 4dle 4dlg 4dln 4dm7 4dmc 4dmf 4dmh 4dmk 4dnf 4dnn 4dno 4do9 4doa 4dob 4doc 4doh 4dox 4dqz 4drf 4ds1 4ds6 4dug 4dun 4dvg 4dyc 4dyj 4dyq 4dyr 4dz1 4dza 4dzj 4dzl 4dzp 4dzs 4dzy 4e00 4e01 4e02 4e08 4e1j 4e1q 4e2a 4e2q 4e35 4e3b 4e4v 4e5y 4e6n 4e6s 4e77 4e8o 4e91 4e92 4eah 4ebc 4ebd 4ebe 4ebj 4ebk 4ec3 4ec8 4ec9 4ecl 4edq 4efo 4eg9 4egs 4eh1 4eha 4ehb 4ehd 4ehf 4ehh 4ehi 4ehj 4ehk 4ehl 4ehn 4ehq 4ekw 4elt 4elu 4elv 4emt 4en5 4ena 4enb 4enc 4eob 4eox 4eoy 4epf 4eqf 4err 4erw 4esy 4et8 4et9 4eta 4etb 4etc 4etd 4ete 4eti 4etm 4etn 4eus 4eut 4evh 4evv 4evy 4ew0 4ew4 4ewp 4eyj 4eym 4ez3 4ez7 4f0i 4f0p 4f0q 4f0r 4f0s 4f0v 4f0y 4f0z 4f1i 4f1y 4f22 4f29 4f2e 4f2f 4f2i 4f2o 4f2q 4f2t 4f2u 4f31 4f39 4f3b 4f3g 4f4m 4f52 4f55 4f5d 4f6c 4f6l 4f78 4f8g 4f8i 4f8u 4f8v 4f95 4f96 4f97 4f9f 4fay 4fbd 4fbx 4fcj 4fcm 4fd9 4fer 4fet 4feu 4fev 4few 4fex 4fey 4ffb 4fft 4fg2 4fg4 4fgo 4fgp 4fgq 4fhr 4fi3 4fi9 4fid 4fix 4fiy 4fk3 4fmm 4fnc 4fo1 4fo6 4fqa 4fqb 4fqu 4fsx 4ft2 4ft4 4fvu 4fwv 4fx0 4fx4 4fx6 4fxq 4fxr 4fz2 4fz4 4fzq 4fzx 4g03 4g04 4g0m 4g0n 4g0o 4g0p 4g0q 4g0u 4g0v 4g0w 4g0x 4g0y 4g0z 4g1j 4g1q 4g3x 4g3y 4g54 4g65 4g69 4g6v 4g7n 4g8b 4g8c 4g8d 4g9e 4g9g 4gaz 4gc6 4gc7 4gd5 4gei 4gew 4gey 4gf4 4gg1 4gg2 4ggg 4ggo 4ggp 4ghi 4ghj 4giw 4gk8 4gkh 4gki 4gkx 4gky 4gmf 4gou 4gp6 4gp7 4gpr 4gpw 4gpx 4gpy 4gr6 4gs9 4gsw 4gu2 4gue 4gvf 4gvh 4gvi 4gvy 4gvz 4gw0 4gw2 4gx8 4gx9 4gxs 4gxy 4gyg 4gyi 4gyr 4gys 4gyw 4gyy 4gz3 4gz5 4gz6 4gzn 4h0n 4h2l 4h36 4h39 4h3b 4h3s 4h4k 4h4n 4h57 4h59 4h5y 4h61 4h7q 4h7x 4h7y 4h81 4h85 4h8p 4h9j 4h9k 4ham 4hcd 4hcw 4hcx 4hcy 4hei 4hga 4hh1 4hn9 4hny 4hqb 4hqi 4hqs 4hqz 4hr0 4hr4 4hr5 4hro 4hrv 4hs4 4hsi 4ht5 4ht6 4ht7 4huh 4hur 4hus 4huz 4hwc 4hwd 4hwi 4hxi 4hy6 4hy7 4hzm 4i2p 4i2q 4i31 4i32 4i33 4i3b 4i3c 4i3d 4i3f 4i4j 4i61 4i62 4i6e 4i6g 4i6j 4i6x 4i86 4icl 4id5 4idk 4idn 4ido 4idp 4idq 4iee 4iei 4ieo 4iep 4ieq 4ier 4ies 4iet 4iev 4iew 4iex 4iey 4iez 4ifv 4ify 4ig0 4ig3 4ihj 4ihq 4iij 4iiw 4ijh 4ijl 4ijs 4ika 4ild 4im8 4io3 4io5 4io6 4io7 4ipc 4ipd 4iph 4ipu 4ipv 4ipx 4iq2 4iqc 4iqf 4iqj 4iqz 4ir8 4irp 4irq 4irx 4isc 4isj 4isz 4it0 4it8 4iu7 4iua 4iui 4ium 4iup 4iuq 4iur 4iut 4iuu 4iuv 4iv2 4iv4 4ivw 4ivy 4iw0 4iw6 4iw8 4iwc 4iwf 4ix4 4ix5 4ix6 4ixn 4iy0 4iy2 4iy4 4iyr 4iys 4j0c 4j0g 4j0h 4j0i 4j0j 4j0k 4j0n 4j19 4j1q 4j3h 4j3n 4j4k 4j56 4j57 4j5t 4j5y 4j6e 4j6o 4j6w 4j6x 4j6y 4j8l 4j93 4jac 4jbf 4jco 4jcw 4jdf 4jeq 4jg2 4jg9 4jgc 4jhd 4jhl 4jin 4jio 4jjo 4jjy 4jlf 4jly 4jme 4jmy 4jn6 4jnn 4joe 4jof 4jog 4joh 4joj 4jok 4jol 4jor 4jpn 4jq0 4js0 4js7 4js9 4jst 4jsy 4jt2 4jt4 4ju8 4ju9 4jua 4jub 4juc 4jud 4juf 4jui 4jyg 4jyh 4jyi 4k00 4k07 4k0s 4k15 4k35 4k3a 4k3b 4k3u 4k40 4k68 4k6m 4k6y 4k70 4k72 4k73 4k75 4k76 4k78 4k7j 4k7q 4k8x 4k8z 4k92 4k9k 4k9l 4k9m 4k9n 4k9o 4k9p 4k9q 4k9s 4ka2 4kbj 4kbl 4kbm 4kbo 4kbq 4kbx 4kc9 4kdv 4ked 4kee 4kef 4kfb 4khq 4khs 4khu 4khw 4khy 4ki4 4ki6 4kil 4kjy 4kkp 4kkq 4kkr 4km5 4kmu 4kn4 4kn7 4kqa 4kqb 4kr2 4kr3 4krs 4kse 4kt3 4kt5 4kti 4ktm 4ku2 4ku3 4ku5 4ku8 4kwc 4kxj 4kys 4kyy 4kz2 4l1c 4l1d 4l27 4l3e 4l3v 4l41 4l48 4l58 4l60 4l62 4l6p 4l79 4l7x 4l85 4l8z 4l90 4l91 4l93 4l94 4l9a 4l9j 4la1 4la5 4la6 4lab 4lat 4lbh 4lbi 4lbp 4lbq 4lcv 4ld1 4ldc 4les 4lg2 4lgt 4li6 4li8 4lid 4lix 4lj0 4llf 4lmg 4ln7 4lpi 4lrv 4ls4 4lsg 4ltb 4ltm 4ltn 4ltz 4luo 4luq 4luv 4luz 4lvn 4lvo 4lvp 4lvr 4lw1 4lw3 4lw6 4lw9 4lwc 4lwe 4lwf 4lwg 4lwh 4lwi 4lwp 4lyp 4lyq 4lyr 4lzi 4lzj 4m0d 4m1p 4m36 4m3q 4m4k 4m4q 4m5g 4m5h 4m5i 4m5j 4m5k 4m5l 4m5m 4m5n 4m5o 4m5q 4m5r 4m5u 4m5v 4m5w 4m6g 4m7p 4m8d 4m8t 4m9e 4mal 4mao 4mb0 4mb2 4mbq 4mck 4mde 4mdf 4mdv 4mea 4meb 4mew 4mex 4mey 4mfg 4mfi 4mg5 4mg6 4mg7 4mg8 4mg9 4mga 4mgb 4mgc 4mgd 4mgq 4mgs 4mh8 4mhc 4mj2 4mjj 4mjk 4mk1 4mk2 4mk5 4mkm 4mks 4mlc 4mm1 4mn4 4mo5 4mo7 4moy 4mp0 4mp2 4mp7 4mpc 4mpe 4mph 4mpj 4mpn 4mpp 4mpr 4mq5 4mq9 4mql 4mqm 4mqx 4ms2 4mtf 4mtg 4mto 4muq 4mur 4mus 4mut 4mvm 4mvo 4mvq 4mvr 4mvs 4mvu 4mvz 4mw3 4mw8 4mwa 4myc 4myh 4myo 4myt 4myu 4mzd 4mzx 4n0a 4n0m 4n0s 4n12 4n27 4n32 4n33 4n3o 4n58 4n5q 4n74 4n75 4n7r 4n85 4n86 4n87 4n9h 4n9i 4nb3 4nbt 4nbu 4nbv 4nbw 4nc4 4ndj 4ndk 4ndl 4ndw 4ndz 4nej 4nem 4ng2 4nj5 4nj7 4njh 4nji 4njj 4njk 4njl 4nl5 4nm0 4nm6 4nmg 4nmo 4nmp 4nmq 4nmr 4nms 4nmt 4nmv 4nnb 4nnc 4nnd 4nnl 4nnm 4noa 4noe 4noo 4nph 4nq0 4nq2 4nqk 4nrh 4ns2 4nsc 4nso 4nsr 4ntp 4ntq 4ntr 4nui 4nuk 4nun 4nuo 4nvr 4nxo 4nxt 4nxu 4nxv 4nxw 4nxx 4ny6 4ny7 4nyi 4nyj 4nym 4o0a 4o21 4o22 4o25 4o2a 4o2b 4o2l 4o2r 4o4h 4o4i 4o4j 4o4l 4o4o 4o6g 4o6h 4o6i 4o6k 4o7j 4o87 4o88 4o8n 4o8o 4o8p 4o96 4o9b 4o9m 4oak 4oau 4oav 4oc8 4odp 4of1 4ogq 4oh3 4oj5 4ojl 4ojo 4ojp 4oky 4ola 4on1 4onj 4onq 4onx 4oo1 4opb 4opc 4opd 4opg 4opi 4opl 4opt 4opu 4oq2 4oq4 4ou0 4ov8 4p52 4p5f 4pdq 4pdw 4ped 4pfq 4pp6 4ppe 4ppp 4pps 4pqv 4prr 4pup 4pus 4pvm 4pvn 4pwe 4pwf 4pwg 4pwh 4pwi 4pwj 4pwk 4pwv 4py4 4py5 4pyh 4pzy 4pzz 4q01 4q02 4q03 4q0r 4q2e 4q2g 4q2u 4q2z 4q30 4q3g 4q3i 4q3j 4q3k 4q3l 4q3m 4q3n 4q3o 4q51 4q5m 4q5p 4q5s 4q5w 4q62 4q6h 4q6s 4q77 4q8i 4q9g 4q9p 4q9q 4q9r 4qak 4qal 4qao 4qb0 4qb8 4qbc 4qbl 4qbv 4qc4 4qc8 4qd7 4qd8 4qd9 4qda 4qdb 4qdj 4qdk 4qef 4qen 4qeo 4qep 4qf1 4qh7 4qh8 4qhc 4qi5 4qi7 4qi8 4qib 4qie 4qif 4qis 4qit 4qiu 4qiw 4qjf 4qjn 4qju 4qk8 4qk9 4qka 4qkk 4qkt 4ql5 4ql6 4qlz 4qm6 4qm7 4qm9 4qma 4qmb 4qmg 4qmh 4qmi 4qmj 4qml 4qmm 4qmn 4qmo 4qmp 4qmq 4qms 4qmt 4qmu 4qmv 4qmw 4qmx 4qmy 4qmz 4qn0 4qna 4qnh 4qo6 4qo9 4qp0 4qpj 4qpk 4qpr 4qq5 4qqs 4qr8 4qrb 4qrf 4qrm 4qsg 4qtf 4qtn 4qtx 4qty 4qu0 4qu5 4qu8 4qu9 4qua 4qub 4qud 4que 4qug 4quh 4qui 4quj 4qul 4qvr 4qvs 4qvz 4qw2 4qwt 4qwv 4qx5 4qyr 4r1z 4r20 4r26 4r28 4r29 4r2a 4r2c 4r2e 4r2p 4r2q 4r2r 4r2s 4r3d 4r3m 4r3q 4r4c 4r4i 4r4l 4r4m 4r4o 4r4q 4r4t 4r59 4r5a 4r5b 4r5s 4r62 4r7e 4r7k 4r7o 4r7r 4r86 4r8i 4r8t 4r94 4r9u 4ra8 4rav 4rca 4rcv 4rcw 4rd0 4rd1 4rd2 4rd3 4rdh 4rdp 4rf6 4rf7 4rf8 4rf9 4rfs 4rgp 4rgw 4rhi 4rhj 4ri2 4ri3 4rir 4ris 4riu 4riv 4rjt 4rki 4rkk 4rnu 4rnv 4rnw 4rnx 4ro3 4rov 4row 4rpc 4rpi 4rqe 4rqf 4rqp 4rr2 4rr3 4rs2 4rs5 4rs6 4rsh 4rsj 4rso 4rt1 4rwr 4rwt 4rx1 4rxh 4ry3 4ryk 4rzb 4s1a 4s2v 4s2w 4s2x 4s2y 4s3j 4s3k 4tpu 4u3f 4ua1 4v5o 4v87 4v8b 4v8c 4v8d 4v8e 4v8f 4v8g 4v8h 4v8i 4v8j 4v95 4v97 4v9a 4v9b 4v9c 4v9d 4v9o 4w5u 4w8k 4w97 4wd0 4wh0 4wh1 4wh2 4wh3 4wqk 4wz0 4wz2 4wz3 4x8y 4xav 4xbl 4xbn 4xbq 4xcw 4xfv 4xi1 4xkd 4xke 4xkf 4xkg 4xq5 4xqo 4xqu 4xrr 4xuv 4xvc 4y14 4y1v 4y1x 4y25 4y5u 4y5w 4yr6 4ytv 4ytw 4ytx 4z04 4z3u 4zkj 4znu 4znv 4znw 5ax7 5ayc 5ayd 5aye 5b42 5b84 5bwl 5bwn 5bwo 5c12 5c5a 5c6h 5ca8 5ca9 5cdv 5cik 5cnx 5cpw 5d4t 5d5n 5d7h 5d97 5dg4 5dm0 5dm1 5dm2 5dm4 5dqr 5dsd 5dt9 5e9d 5ech 5eci 5eck 5ecl 5ecm 5ecn 5eco 5ecp 5ecq 5ecr 5ecs 5efs 5eid 5ejo 5enz 5epf 5eur 5ey0 5ey1 5f2k 5f2n 5f2o 5f46 5f47 5f48 5f49 5f51 5fa9 5fbt 5fcf 5fch 5gmr 5gms 5gn1 5gta 5gva 5gvb 5gvs 5gwx 5gzz 5h00 5h01 5h02 5h1y 5h6z 5h9y 5hii 5hij 5hik 5hil 5him 5hkl 5hnm 5hp2 5hp3 5hsi 5hsj 5ht0 5i0c 5i0p 5i1f 5i4c 5i5n 5i5o 5ig9 5ing 5ir0 5isp 5iwz 5izt 5j43 5j4a 5j5f 5j5g 5j5h 5j5i 5j5v 5jd3 5jd4 5jd5 5jd6 5jj5 5jjv 5jrk 5jry 5jsc 5jvv 5jws 5jwt 5jwu 5jwv 5jww 5k21 5k2a 5k3g 5k3h 5k3i 5k79 5k8j 5kha 5kia 5kue 5kug 5kui 5kuj 5kvk 5l4s 5l51 5l53 5l90 5lcx 5ldg 5ljf 5ln8 5lo7 5n6g 5n6q 5n7l 5nx4 5nx5 5nx6 5o4f 5oiu 5oon 5scm 5scn 5sco 5scp 5scq 5scr 5scs 5sct 5scu 5scv 5scw 5scx 5scy 5scz 5sd0 5sd1 5sd2 5sd3 5sd4 5sd5 5sd6 5sd7 5sd8 5sd9 5sda 5sdb 5szx 5t01 5t1p 5tab 5ted 5teu 5thq 5tpw 5ttj 5ttk 5u2w 5u6g 5u8j 5ub8 5ubd 5ube 5ubf 5uby 5ubz 5uc7 5ucc 5ue7 5uf8 5uk9 5um2 5um7 5uoz 5us1 5uvr 5uxa 5uxb 5uxc 5v3w 5v68 5v6l 5v6m 5vkw 5vm2 5vn6 5voe 5vqb 5vt4 5vu3 5vve 5vxq 5vyv 5vz1 5w2b 5w48 5w4y 5w4z 5w7l 5wbf 5wm9 5wug 5wvp 5ww0 5wx9 5x2d 5x49 5x8z 5x9y 5xe8 5xe9 5xf7 5xi5 5xjn 5xjw 5xkj 5xkl 5xrb 5xrd 5y1j 5y69 5y9q 5yav 5yaw 5ydp 5yhr 5yov 5yps 5yty 5yv7 5yxy 5yzm 5z2x 5z40 5z48 5z72 5z7h 5z9z 5zby 5zn8 5ztl 5zuj 5zyf 5zzo 6a6p 6a8l 6a8m 6a8z 6a9t 6a9u 6a9v 6abo 6aef 6ako 6akp 6all 6aoj 6aok 6ask 6asl 6avj 6b5f 6b6z 6baq 6bj9 6bja 6bmn 6bnc 6bnd 6bne 6bnf 6bpa 6bpb 6bpc 6bpd 6bpe 6brd 6bvc 6c71 6c8q 6c9o 6cd7 6che 6cka 6cpz 6crm 6cyl 6d2w 6d2x 6d2y 6d33 6d7j 6di4 6e0s 6eac 6eb1 6eb2 6er9 6era 6ezw 6f0d 6f6d 6fne 6fpp 6fxd 6gf7 6gny 6h86 6hpv 6hrl 6hur 6hzn 6i1d 6icj 6igb 6ihg 6iie 6ilq 6inx 6j4e 6j4f 6jau 6jbx 6jl3 6jow 6jtg 6jyy 6k73 6kbw 6kel 6keo 6khq 6l1e 6l1r 6l5k 6lhx 6lhy 6liu 6liv 6lkn 6lun 6lw3 6lz7 6lzh 6lzi 6lzj 6lzk 6m8t 6m8u 6m8v 6mco 6mgj 6mgk 6mgl 6mij 6mmz 6mn0 6mn1 6mn2 6mn3 6mn4 6mn5 6mpz 6mr3 6msw 6n34 6nps 6nsi 6o62 6o6q 6om4 6ori 6ov7 6ox6 6oz1 6p0i 6p0j 6p0k 6p0m 6p0n 6p2k 6p2l 6p2m 6p2n 6p2o 6p3c 6phi 6pi9 6pny 6pqh 6pta 6pw0 6pyo 6pyx 6qbt 6qbw 6qdj 6qnk 6r15 6r16 6r17 6r2i 6rau 6rix 6riy 6riz 6rnq 6rns 6rpq 6tj0 6u0a 6u0j 6u1u 6u69 6u6a 6u73 6uc6 6ude 6udf 6udg 6uhx 6ujd 6ujo 6ujq 6uk2 6uk4 6umg 6unv 6uts 6utu 6v84 6vbk 6vkf 6vop 6voq 6vsx 6vxs 6vxv 6vza 6vzb 6w0s 6w2g 6w2h 6w2i 6wj8 6wop 6wqb 6wqc 6xep 6xi1 6xi3 6xi4 6xi5 6xnj 6xnq 6xrb 6xrf 6xrr 6yuq 6ywp 6z30 6z46 6z4r 6z4t 6zie 7a0h 7a54 7a5x 7at9 7atv 7b7n 7bgm 7bgn 7bhd 7bq6 7bq7 7btj 7buz 7bvi 7cji 7cla 7crv 7cuz 7d47 7d4k 7dbs 7dki 7dmw 7doo 7dqg 7e4w 7ed6 7ed9 7ee2 7eee 7eej 7ejg 7eka 7eow 7er3 7er6 7er7 7er8 7er9 7era 7erb 7erc 7erd 7ere 7esg 7esx 7esy 7esz 7et0 7f60 7f6l 7f8l 7fbh 7fbo 7fcn 7fdp 7fgp 7jh0 7jj8 7jjb 7jkm 7jm0 7jm1 7jm2 7jzo 7jzp 7jzq 7jzr 7k47 7k62 7k6c 7k74 7k7y 7kag 7kes 7kf3 7khn 7kho 7ki8 7ki9 7kli 7km7 7km8 7km9 7kno 7knp 7kqa 7kqy 7kqz 7kxa 7kzw 7l2a 7l32 7l3o 7l6c 7l6s 7l84 7l9r 7lao 7lap 7lgo 7luy 7lv7 7lvc 7lyx 7lyy 7m2d 7m3k 7mcj 7mgq 7mhb 7mi0 7miw 7mm1 7mmz 7mpy 7mwa 7mx5 7n6s 7n79 7n7s 7ng2 7nh2 7ofz 7og0 7p4o 7pud 7qa1 7qrh 7r6r 7ra4 7rca 7rcr 7re8 7re9 7reu 7rge 7rgn 7rin 7rj1 7rll 7rqg 7s2i 7s2j 7s2k 7s2l 7s2m 7s5n 7s8k 7sbj 7sir 7skb 7snu 7spn 7sy9 7szp 7t0y 7t35 7t4z 7t50 7t51 7t5a 7t9w 7tbu 7tbv 7tcm 7tgp 7ti7 7ti9 7tog 7toh 7toi 7toj 7tok 7tq1 7ttz 7udm 7ulb 7ulq 7uls 7ulz 7uq0 7uuj 7uuk 7uul 7uum 7uun 7uuo 7uxg 7v09 7v3z 7vft 7vlm 7vp2 7vp3 7vp4 7vp5 7vp6 7vp7 7vtk 7vtm 7vu3 7vuf 7vuk 7vvh 7vyu 7w54 7w9h 7wku 7wo1 7wo2 7wo3 7wof 7woh 7wvb 7ww4 7wwc 7x77 7x7d 7x7e 7xhz 7xmj 7xqn 7ygh 7ygl 7yhl 7yll 7yoc 7z8y 7z8z 7zc3 7zit 8a45 8adx 8amp 8amq 8b1n 8b46 8b5x 8bbu 8bbw 8bny 8bxy 8c05 8c66 8cp4 8cwp 8d1x 8d2z 8d57 8d5g 8d5h 8d5i 8dp9 8dpa 8dvc 8dvh 8e10 8e11 8eju 8ejv 8ent 8ewa 8ewo 8ez1 8ezr 8ezs 8ezt 8f09 8fsq 8fza 8g32 8grt 8gu4 8gul 8gum 8h1e 8h1f 8h1g 8h92 8hdu 8hdv 8hek 8hel 8hmg 8hmh 8hml 8hoe 8htw 8hu2 8i8y 8ib1 8in7 8ina 8ind 8iom 8iud 8j1w 8j6h 8jb3 8jbb 8jbc 8jcr 8jcs 8jh1 8jpa 8qeu 8qev 8r2g 8rke 8rkf 8rkg 8rkh 8scd 8sdc 8sdd 8sxs 8tji 8tjj 8tjk 8tkl 8tkm 8tkn 8tn1 8tqx 8tsv 8vy8 8w6p 8w6r 8wct 8x39 8x8p 8xab

PHENIX-AUTOSOL

4d9g

PHENIX-AutoSol

4hh0 4hh2

PHENIX/AutoSOL

4k3c

POLARRFN

1ae7

PROLSQ/PROFFT

1a2q 1ak9 1aqn 1au9 5chy

PROTEIN

1anf 1bvn 1c4f 1dxg 1eay 1ema 1ex1 1h2r 1id2 1igr 1jg5 1ly3 1ly4 1mvs 1mvt 1pd8 1pd9 1pdb 1s3u 1s3v 1spp 1tld 1u70 1u71 1u72 207l 2fx5 3mbp 3myw

PROTSYS

1bfd 3rhn 4rhn

PURDUE

1ijs 1mvm

PYMOL

4q4v 4q4w 4q4x 4q4y

Patterson

3nyk

Phenix-AutoSol

4nqf

Quanta

1c1n 1c1o 1c1p 1c1q 1c1r 1c1s 1c1t 1c1u 1c1v 1c1w 1c2d 1c2e 1c2f 1c2g 1c2h 1c2i 1c2j 1c2k 1c2l 1c2m 1c5l 1c5m 1c5n 1c5o 1c5p 1c5q 1c5r 1c5s 1c5t 1c5u 1c5v 1c5w 1c5x 1c5y 1c5z 1hv7 1o2g 1o2h 1o2i 1o2j 1o2k 1o2l 1o2m 1o2n 1o2o 1o2p 1o2q 1o2r 1o2s 1o2t 1o2u 1o2v 1o2w 1o2x 1o2y 1o2z 1o30 1o31 1o32 1o33 1o34 1o35 1o36 1o37 1o38 1o39 1o3a 1o3b 1o3c 1o3d 1o3e 1o3f 1o3g 1o3h 1o3i 1o3j 1o3k 1o3l 1o3m 1o3n 1o3o 1o3p 1o5a 1o5b 1o5c 1o5d 1o5e 1o5f 1o5g 1qhr 1uwv 2aub 4u0i

RANTAN

1b9m

RAPD

4kzd 4kze

RASMOL

2al1

RAVE

1a6c 1b14 1b15 1b16 1b2l 1bcc 1ej6 1f15 1fnt 1gyq 1ihf 1ki4 1lp3 1mpr 1ng0 1p7b 1pci 1qsd 1uf2 1vcb 2bcc 2ffh 2gbl 2gh8 2gp1 2mpr 2wll 3dvl 3es5 3h1h 3h1i 3hag 3m8l 3qpr 4v60

REFMAC

1gy3 2vxi 4av3 4bk9 4cfo 5gvr 5x16 6ay0 6xsc 6xsh 6xsi 7kwh

REMO

3h5k

REPLACE

1kev 1wip 2wpo

RESOLVE

1i8u 1iul 1izm 1j5p 1j5s 1j5u 1j5w 1j5x 1j5y 1j6r 1j6s 1jo0 1jp3 1jpl 1k4j 1kcf 1khc 1kps 1kq3 1kq4 1kwi 1kxj 1l7l 1la2 1lf7 1lzk 1mki 1mn3 1mo0 1mpx 1mqs 1muf 1mwq 1mww 1n57 1n7k 1n9k 1naq 1ne8 1nmn 1nzn 1o13 1o1x 1o1y 1o1z 1o20 1o22 1o24 1o25 1o26 1o27 1o28 1o29 1o2a 1o2b 1o2d 1o3u 1o3x 1o3y 1o4w 1o50 1o51 1o58 1o59 1o5h 1o5j 1o5l 1o6a 1oqf 1p16 1p1l 1p1m 1p5f 1p5t 1pn3 1pnv 1psq 1psu 1psw 1pug 1pui 1puj 1pxz 1q25 1q43 1q44 1q5z 1q9j 1qy9 1r4w 1r6v 1r8g 1rkq 1rpy 1rr7 1tm0 1tqh 1tv5 1uc2 1ud9 1vj1 1vjf 1vjl 1vjn 1vjt 1vk3 1vk8 1vkh 1vky 1vl0 1vl5 1vll 1vlu 1wq6 1wzc 1x6i 1xrh 1y89 1yis 2a2l 2es7 2es9 2euc 2f6s 2f9c 2g1m 2h6d 2nwh 2o0y 2omo 2pz9 2q24 2qnu 3aj3 3b1n 3bed 3ca8 3cdh 3cni 3d59 3dcl 3dtd 3ea0 3ebb 3ebq 3ec6 3ec7 3ect 3ed5 3edp 3eef 3efb 3egl 3elk 3eo4 3erm 3ewl 3exz 3eyt 3f1b 3f1t 3f2z 3f42 3f5b 3f5r 3f67 3f6c 3f6m 3f6v 3f6w 3f9u 3fb2 3fbk 3fc7 3fes 3fet 3feu 3ff4 3ffh 3fg8 3fgb 3fgg 3fh0 3fia 3fk8 3fke 3fnb 3fpi 3fq6 3frm 3ftt 3fvw 3fwz 3fz4 3fz5 3fzv 3g64 3g6s 3g74 3g8w 3g9q 3gby 3gdw 3gdz 3ge2 3gfv 3ghd 3gku 3gkx 3gl5 3goz 3gqq 3gve 3gx1 3h1q 3h3m 3h5q 3h8h 3h9p 3hbc 3hdt 3hiu 3hix 3hjj 3hl0 3hlu 3hly 3hm2 3hm7 3hn2 3hnw 3hsi 3htr 3hyl 3hyq 3hzh 3i38 3i4p 3i8o 3ibz 3ic6 3ic7 3icc 3igj 3ign 3ih5 3ih6 3ij6 3ilm 3ilx 3ipl 3irs 3iru 3iuv 3iv1 3iv6 3ix7 3ju1 3ju3 3ju8 3jvc 3k0l 3k3s 3k63 3k6c 3k6h 3k6r 3k7x 3kao 3kbg 3kdq 3kew 3kkc 3kkz 3kmi 3kn3 3knw 3ksu 3ktb 3kts 3kty 3kv1 3kwo 3kwp 3kye 3kzl 3kzp 3l0z 3l5z 3l6w 3lao 3lay 3led 3ler 3lgc 3lhk 3ljl 3ll7 3llw 3lno 3lnp 3lo3 3loc 3lq1 3lq7 3lqy 3lso 3lte 3lup 3lvu 3lyd 3m05 3m0z 3m49 3m5u 3m5v 3m6j 3m84 3mah 3maj 3mgl 3mj6 3mkl 3mnf 3mog 3mqz 3mr0 3mt1 3mwc 3mxq 3mxt 3mzn 3n05 3n28 3n2q 3n3t 3n73 3n7z 3n8h 3na2 3nat 3net 3nf2 3ni7 3nja 3nkg 3nkh 3nkz 3nnj 3nqr 3nvq 3nwg 3oco 3on3 3ono 3onp 3op4 3os4 3os6 3osf 3ouz 3ovk 3oyr 3ozh 3p2a 3p2l 3p8l 3p8r 3pei 3pn9 3q1o 3qjo 3qmn 3qod 3qok 3qqv 3qtd 3qtt 3r3t 3rao 3rbn 3re2 3rmg 3rqr 3rxz 3s2w 3s7z 3sae 3sdq 3sdr 3sdt 3sdu 3srt 3t22 3tov 3tva 3ty7 3u12 3u4y 3udo 3udu 3usb 3uwd 3v0r 3v48 3v4d 3v6p 3we9 4dzr 4e4y 4e5u 4eae 4eo2 4er9 4erh 4fca 4fmw 4g6q 4gs5 4gxt 4hcg 4hci 4hcj 4hvm 4igv 4iqd 4iqn 4ir0 4kd5 4kjm 4mtk 4mx8 4my0 4my3 4nsw 4o9i 4p29 4pib 4q63 4q6w 4q7a 4rhp 4rt0 4tv7 4u48 4uar 4wky 4xrm 5bnz 5bo4 5c54 5cv1 5d1i 5ed7 5fd7 5gha 5h8i 5hxy 5hz2 5i44 5i90 5j06 5kgo 5nuo 5uqj 5xev 5yzm 5yzn 5zhw 6hfz 6htj 6ivh 6k8s 6njy 6q82 6wfv 7dio 7fcr 7l5i 7l5s 7n7v 7p41 7u2v 7ux0 8a56 8bke 8ewh 8j9c 8j9d 8jcq

REVISE

1b9m

ROTAVATA

1eym

ROTFUN

6csc

RSPS

1b1c 1b9m 1k32 1pyz 1svf

RSREF

1d2r

RSS

1eay 1tmy 2tmy

Rantan

2yqz

Regid

3vy8

Rosetta

3nr6 4j38 4j5m 4m1b 4mee

Rotptf_6D

1j72

SAM-T08

4hd5

SAPI

1rsg

SCA2STRUCTURE

2hjm 2hq8 2hqe 2icu 2pw6

SCALEIT

1vhb

SEE

1ajr 1ajs

SFALL

1bt9

SGXPRO

2i0x 2p17 2qvo 2qwu 3nyc 3o3k 3qxy 3rc0 3tb7 4lt5

SHAKE

1byz 1cc8 1g5h 1qcz

SHAKE-N-BAKE

1a0m 1a7a 1aho 1akg 1b4f 1not

SHARP

1ojv 1ojw 1ok1 1ok2 1ok3 2c9o 2ix1 2jg1 4v5o 5xhc 5xi7

SHELX

1b0y 1b7g 1b8c 1b8l 1bkr 1bs9 1bx8 1c7d 1cb0 1cku 1d3r 1ddg 1ey0 1ey4 1ey5 1ey6 1ey7 1ey8 1ey9 1eya 1eyc 1eyd 1ez6 1ez8 1f94 1fd3 1g6x 1i2k 1ibq 1iho 1ijh 1ijv 1im8 1j8b 1j8d 1j9a 1jo0 1jr0 1k3l 1k3o 1k3x 1k6a 1k6u 1kmz 1kqx 1kt3 1kt4 1kt5 1kt6 1kt7 1ky8 1kyf 1kyp 1kyr 1kys 1l3k 1l7l 1lqp 1lu4 1lug 1m0k 1m0l 1m0m 1m15 1m69 1mep 1mf5 1mwq 1mxt 1n1p 1n43 1n4u 1n4v 1n4w 1n7z 1nf8 1nf9 1nfs 1nfz 1nki 1nlu 1nnx 1no5 1npi 1nqd 1nqj 1nyk 1nym 1nz0 1o08 1o0a 1o1l 1o1n 1o1o 1o1p 1o5x 1onk 1oo2 1oq5 1or4 1os6 1oun 1ow2 1p1v 1p1x 1p5f 1p6o 1p9g 1pc4 1pc5 1pi3 1pkh 1ppv 1ppw 1pvf 1pvv 1pwc 1pxg 1pym 1q0e 1q54 1q5y 1qfi 1qhb 1qsp 1qv0 1qv1 1qyf 1qyk 1qyl 1qyz 1qzm 1r0q 1r1c 1r67 1r6j 1r85 1re9 1rgz 1rho 1rpi 1rqy 1rwy 1s0q 1s0r 1s2x 1s6r 1s8f 1scw 1sde 1sfs 1six 1sjz 1sk0 1sk1 1sk2 1skg 1sl9 1soa 1ssx 1t18 1t19 1t1a 1t1b 1t1c 1t3y 1t6u 1td4 1tf9 1tkf 1tkh 1tkj 1tmm 1tqg 1tt8 1tth 1tu0 1tug 1u7r 1u7s 1ucr 1v4f 1v6p 1v6q 1v7h 1v9y 1vb0 1vk4 1vkb 1vlc 1vlq 1vmf 1vmg 1vmi 1vp4 1vp7 1vpm 1vrx 1wdp 1wdq 1wdr 1wli 1wma 1wmd 1wme 1wmf 1wr5 1wri 1wuh 1wui 1wuj 1wuk 1wul 1wxc 1x1k 1x8n 1x8o 1x8p 1x8q 1x97 1x98 1xbu 1xs1 1xt5 1xvm 1xvo 1xy1 1xy2 1y3i 1y3u 1y3y 1y54 1y59 1y5a 1y5b 1y5u 1y5v 1y5w 1yg9 1ylj 1ylp 1ylt 1yly 1ylz 1ym1 1yp9 1ype 1ypg 1ypj 1ypk 1ypl 1ypm 1yqs 1yum 1yun 1yvm 1ywr 1z3n 1z53 1z89 1z8a 1zby 1zbz 1zfq 1zge 1zgf 1zgo 1zh9 1zlb 1zlm 1zoe 1zoh 1zpa 1zvj 2a28 2a6y 2a6z 2a70 2ab0 2akz 2amj 2aoc 2aod 2aoe 2aof 2aog 2aoh 2aoi 2aoj 2aqd 2as1 2as2 2as3 2as4 2as6 2axe 2b0a 2b2k 2b97 2bc3 2cuo 2cws 2cyz 2cz0 2cz1 2d5m 2d8l 2dlb 2drt 2drx 2due 2duh 2dui 2dux 2duz 2dv0 2dyw 2ea0 2ekt 2eku 2ewf 2ewg 2ewi 2ewk 2ewu 2eyu 2f01 2f2n 2f4a 2f4g 2f4k 2f5m 2f6s 2f80 2f81 2f8g 2f9c 2fcw 2fdn 2ffy 2fju 2fma 2fn3 2fnw 2fou 2fov 2fwe 2fwf 2fwg 2fwh 2fwn 2fz8 2fz9 2fzb 2fzd 2g58 2g69 2g73 2g74 2ger 2gh7 2gi9 2gwa 2gzs 2h1v 2h5o 2h5p 2h5q 2h5r 2hb3 2hcm 2hqk 2hs1 2hs2 2hv5 2hvn 2hvo 2hwq 2i16 2i19 2i1x 2i20 2i21 2ia8 2id8 2ief 2igv 2igw 2ija 2ikg 2ikh 2iki 2ikj 2nso 2ntu 2ntw 2nvc 2nvd 2o0d 2o0e 2o0x 2o0z 2o15 2o1i 2o8o 2o8r 2o9s 2odu 2odv 2oko 2or3 2p0i 2p74 2p7o 2pd5 2pd9 2pdb 2pdc 2pdf 2pdg 2pdh 2pdi 2pdj 2pdk 2pdl 2pdm 2pdn 2pdp 2pdq 2pdu 2pdw 2pdx 2pdy 2pkv 2pl4 2pl8 2plb 2pmb 2pod 2poh 2pq5 2pwa 2pwc 2pwr 2pwv 2pzn 2q1b 2q38 2q9d 2qca 2qd7 2qdd 2qh5 2qii 2qnn 2qnp 2qsd 2quo 2qxw 2qzr 2r1f 2r38 2r3t 2r3w 2r43 2rav 2rb5 2rbk 2rdx 2rin 2rk3 2rk4 2rk6 2trc 2yyw 2yyx 2z1v 2z1w 2z1x 2z72 2z7k 2z8a 2zbm 2zc9 2zcf 2zd8 2zda 2zdk 2zdl 2zdm 2zdn 2zdv 2zf0 2zff 2zfp 2zfq 2zfr 2zfs 2zft 2zg0 2zga 2zgb 2zgx 2zhd 2zhe 2zhf 2zhi 2zhj 2zhq 2zhw 2zi2 2ziq 2zjx 2zk9 2zmx 2zmy 2zmz 2znk 2zo3 2zoh 2zq1 2zq2 2zvx 3a08 3a09 3a0a 3a0m 3a0n 3a19 3a1h 3a38 3a39 3al7 3ald 3aok 3apo 3apq 3aps 3b1n 3b64 3b6l 3b72 3b7v 3b80 3ba1 3baz 3bc4 3bcj 3bgb 3bgc 3bh1 3bhe 3bjs 3bk8 3bld 3bll 3blo 3bma 3bq9 3bqp 3but 3bva 3bvb 3bwp 3by5 3c19 3c2y 3c6f 3c6x 3c6y 3c6z 3c70 3c8c 3cfy 3cg4 3cga 3ci7 3ckt 3cku 3cp5 3cs3 3ctw 3cu9 3cz9 3cza 3d1y 3d31 3d43 3d49 3d5y 3d9s 3d9z 3daz 3dbu 3dc3 3dc9 3dcc 3dcs 3dcw 3dd0 3dha 3dhk 3dt0 3dty 3dup 3dux 3dxi 3e05 3e18 3e82 3eaf 3eey 3eli 3eq0 3eur 3ewe 3ewm 3ewn 3exn 3ezg 3f0c 3f1c 3f2i 3f5d 3f71 3f8v 3f9l 3fa0 3fad 3fcd 3fdi 3fh3 3fhl 3fij 3fkd 3fl6 3flh 3fni 3fnr 3fp9 3frn 3fvw 3fyf 3g0o 3g21 3gc4 3gg9 3gjz 3gn3 3gqq 3gvx 3gzy 3h31 3hdg 3hdo 3heb 3hhh 3hjj 3hqx 3huh 3hyl 3hz4 3i5e 3i5l 3ibm 3ieb 3ifu 3igi 3igj 3ij6 3ikg 3ilh 3ipl 3iq1 3irs 3irv 3isa 3iuj 3iuk 3iul 3ivr 3jt2 3jtb 3ju2 3jvd 3jy6 3k0b 3k2w 3k63 3k9d 3k9z 3kbj 3kbm 3kbn 3kbs 3kbv 3kbw 3kew 3kne 3knw 3koi 3kok 3kol 3kon 3ksu 3kts 3kzh 3l0z 3l14 3l49 3l60 3l8w 3l9g 3lbg 3ld4 3lgc 3lkl 3llw 3lm4 3lmd 3lom 3lq1 3lq7 3lqk 3lte 3lv9 3lvs 3m1y 3m23 3m25 3m26 3m27 3m28 3m29 3m2a 3m2b 3m2c 3m2d 3m2e 3m2f 3m2g 3m2h 3m2i 3m38 3m39 3m3a 3m3b 3m49 3m84 3m8n 3m9l 3m9u 3mae 3mc1 3mgg 3mgk 3mj6 3mkc 3mkv 3mn0 3mn1 3mog 3mwc 3mwz 3mzn 3n05 3n28 3n3d 3n8h 3nco 3ndt 3ndu 3ndw 3ndx 3ne0 3nf2 3ny7 3odm 3ogh 3ohr 3oj0 3ok4 3olo 3on4 3onb 3onc 3op9 3os4 3ost 3ouz 3oyr 3p8l 3p8r 3p9o 3pa0 3pdg 3pe0 3pe9 3pei 3pes 3pfy 3pg5 3pg6 3pko 3pp5 3ppu 3pqh 3pu9 3pz9 3pzj 3q1o 3q3e 3q3h 3q3i 3q4h 3q63 3q64 3q7s 3q98 3qoc 3qod 3qom 3qoo 3qqv 3qr7 3qr8 3qsj 3qtt 3qys 3r0p 3r1x 3r6a 3r79 3rhf 3rht 3rjx 3rmg 3rmq 3ros 3rot 3s52 3s7z 3s9x 3sho 3sm0 3sng 3tek 3tfw 3tfx 3tix 3tp9 3trt 3ttg 3tua 3tvb 3u2r 3uaa 3uab 3uac 3uad 3uae 3ucp 3uh8 3utu 3v49 3v4a 3v7p 3vhg 3wa1 3wou 3wyd 4dim 4dzi 4e34 4e5s 4e61 4e94 4e9q 4e9r 4e9s 4e9t 4e9v 4e9w 4e9x 4e9y 4esv 4evq 4evr 4evs 4evu 4evx 4eys 4g12 4gb5 4gbf 4gbj 4gio 4gud 4gyt 4h3t 4h3v 4h4a 4h7l 4hc5 4he5 4hwx 4hxe 4i1f 4i66 4ip2 4ir0 4ix9 4j8c 4jiu 4jix 4jj2 4jpz 4kd5 4kq9 4ktw 4leu 4lyb 4lyc 4lzk 4mcw 4me2 4mt8 4mtm 4mtx 4mv2 4mve 4n1i 4n4u 4nag 4o7k 4ofk 4oqc 4ovb 4pgo 4poe 4pr8 4pss 4pst 4psy 4pth 4ptj 4puv 4q37 4qrz 4qsc 4qsd 4qse 4r0d 4r2b 4r2f 4r5q 4r6h 4r6y 4rg9 4rgc 4rk1 4rk2 4rk6 4rk9 4rkq 4rpf 4rs3 4rsm 4ru1 4rxl 4rxm 4rxt 4rxu 4ry0 4ry1 4ry8 4ry9 4rya 4tx9 4xea 5g1v 6chk 7qe3

SHELX-90

1ftn 1jfr 1jkm 1shk 2isd 2shk

SHELX-96

1a6d 1nst 1sho

SHELX-97

1g3p

SHELX90

1vhb

SHELXD

5xhc 5xi7

SHELXDE

5j4f 5j4g 5j72

SHELXE

1nr0 1nyk 1ovn 1rkq 1rzn 1s9b 1sny 1swy 1t92 1twy 1vs1 1wzz 1xv2 1xvl 1xvx 1y5h 1y6x 1ylx 1yxy 1z6m 1z72 1z7l 1zma 1zs7 1zwy 1zx5 2a1v 2adw 2aee 2ahr 2anu 2anx 2av9 2axw 2b67 2b9w 2b9x 2csg 2dg2 2e4t 2e6u 2et0 2f06 2f4l 2f96 2f9h 2fdo 2fdr 2fef 2fex 2fgc 2fhp 2fhq 2fiq 2fiw 2fml 2fqz 2fs5 2fu2 2fyw 2g39 2g3a 2g3b 2g7u 2g7z 2g9i 2gau 2gb7 2ge3 2gfn 2gm3 2gmq 2gmy 2gpy 2gre 2gs5 2gta 2gtq 2gts 2gu2 2guh 2guk 2gup 2gux 2gz4 2h0u 2h5n 2h8o 2hay 2hhg 2hhz 2hj1 2hma 2hmc 2hng 2ho5 2hqv 2hr3 2hrz 2hs5 2hxo 2hxr 2hyj 2hzg 2i00 2i0m 2i1s 2i2l 2i4r 2i52 2i5e 2i5u 2i6d 2i6x 2i71 2i79 2i7g 2i7h 2i8e 2i9c 2i9x 2ia1 2ia2 2iaf 2iai 2iaz 2id3 2id8 2idl 2if7 2ig8 2igs 2igt 2ijc 2ikb 2ikk 2iqq 2iqt 2nl9 2np3 2np5 2npn 2nqw 2nrk 2nx2 2nx4 2nzc 2o03 2o0m 2o0y 2o1t 2o1v 2o2a 2o30 2o35 2o38 2o5h 2o8n 2o9x 2oai 2ocz 2od0 2odf 2odi 2oeb 2oeq 2oer 2oez 2ofy 2og4 2oiw 2ojh 2ols 2ozv 2ozz 2p0o 2p13 2p3h 2p3p 2p4p 2p5z 2p67 2paq 2pc6 2pd0 2pfs 2ph0 2pkh 2pli 2pmq 2pmr 2pnw 2pp6 2ppx 2ptf 2pw9 2pz9 2q1m 2q24 2q5e 2qdn 2qf9 2qgy 2qjo 2qkp 2qm0 2qm3 2qmo 2qqy 2qqz 2qr3 2qr4 2qrr 2qru 2qsb 2qsi 2qsj 2qsr 2qu7 2qv0 2qw6 2qwt 2qx2 2qy6 2qya 2qyb 2qzb 2r0b 2r48 2r4q 2r5f 2r5x 2r8d 2rbc 2rd7 2rdm 2rdp 2rgj 2rgy 2rjo 2rjz 2zf9 2zpl 2zpm 2zy6 3aj3 3ajv 3b0z 3b1s 3b40 3b49 3b85 3b8b 3bc8 3bca 3bgh 3bhw 3bil 3bm3 3bo6 3bqy 3bs3 3bs4 3bv8 3c3m 3c6v 3c8p 3c8t 3c97 3c9a 3cam 3cax 3cbt 3cbw 3cdx 3ce2 3ced 3cex 3cg4 3cg8 3ci6 3cit 3clw 3cmg 3cni 3crn 3cta 3ctd 3ctr 3cyj 3czc 3d0f 3d19 3dci 3ddh 3dew 3dgt 3dhu 3dip 3dns 3dtd 3dtn 3e0s 3e2v 3e3m 3e4f 3e61 3e78 3e79 3e8v 3e9n 3ebv 3edm 3eeq 3efg 3egc 3ego 3eh7 3elk 3emu 3emx 3epr 3eqz 3er6 3erv 3esm 3evt 3evy 3exc 3eye 3eyp 3f13 3f3k 3f4a 3f6c 3f6w 3fbg 3fbt 3fc3 3fd3 3fdj 3fdu 3fdw 3fhk 3fi9 3fid 3fk9 3fma 3fn2 3fna 3fnc 3ftt 3fx3 3fzv 3g27 3g2e 3g5j 3g7y 3g9b 3g9y 3ga4 3gby 3gdo 3gfo 3gg2 3gg7 3ghf 3gkb 3gm8 3gmg 3gms 3gnl 3go2 3gox 3gp4 3gpi 3grn 3gt5 3gt7 3gtz 3guv 3guy 3gwh 3gwy 3h0u 3h2t 3h35 3h36 3h5i 3h5l 3h75 3he0 3hfr 3hh1 3hjv 3hmq 3hsi 3hur 3hxr 3hzq 3i0t 3i1d 3i4p 3i6t 3i6v 3i83 3i9f 3i9x 3ian 3ib6 3ibz 3ic3 3ic6 3icc 3icj 3ih6 3iii 3ijd 3ijm 3ilx 3imh 3imi 3ioy 3ipi 3iqt 3iru 3itf 3iv1 3iv3 3ivd 3iwa 3ix7 3jrv 3jtf 3ju3 3jw4 3k13 3k2g 3k2v 3k6c 3k6r 3kao 3kep 3kes 3kfo 3kfw 3kg4 3kgz 3khn 3kke 3kl2 3km5 3kmi 3kq5 3kwp 3kzl 3l5z 3l8k 3l9a 3led 3lhk 3lhx 3ll7 3lqy 3lso 3luf 3lup 3lvu 3lx6 3lxz 3lyd 3m0z 3m1g 3m4r 3m6j 3m92 3maj 3mcz 3mdk 3mfd 3mgl 3mkl 3mnf 3mt1 3mxq 3my9 3mzv 3n2q 3n3t 3n7c 3n7z 3nbm 3ndh 3nek 3net 3niw 3o66 3o6p 3obf 3oc4 3ocr 3oir 3oiz 3omb 3omd 3op4 3oqg 3os6 3ot1 3owc 3p01 3peb 3pf6 3pve 3pwx 3q6p 3q6t 3q9g 3q9j 3qbr 3qf4 3qf8 3qok 3qor 3qsl 3qtd 3quf 3qvo 3qvq 3rao 3re2 3rk6 3rpd 3rpj 3rxz 3sng 3soy 3spe 3svi 3t61 3t6o 3trt 3tx6 3tzt 3u0h 3u1d 3u24 3u3l 3u4g 3u7v 3ub0 3uc9 3udo 3udu 3urh 3us8 3uyb 3v48 3v4d 3vwb 3w1o 3wis 3wqc 3wqd 3wqe 3wqf 3wqg 4d02 4d91 4dup 4e3z 4e61 4e7y 4e8s 4e95 4ej6 4eo2 4eyz 4f3a 4f3s 4f8j 4fb4 4fgd 4fgi 4frf 4g10 4gqa 4h62 4h7n 4h89 4hb7 4hb9 4hbz 4hc8 4hes 4hex 4hg2 4hkt 4hy3 4i43 4iag 4igv 4ix9 4j2u 4jcu 4jfc 4jos 4jsb 4jvt 4jwt 4jxq 4jxr 4kd6 4kn5 4kpk 4l0m 4ldn 4lk5 4lkb 4low 4lqk 4m1a 4m3s 4mj9 4mwg 4neo 4o9i 4q4a 4qaz 4qb5 4r31 4r8j 4rbr 4re7 4rgk 4rgr 4rgs 4rgu 4rgx 4rh4 4rha 4ro5 4rqm 4tn8 4tno 5dml 5eos 5kx4 5lx8 5olp 5omt 5opj 5v2h 5v8k 5xi8 6g8a 6g8b 6goc 6r17 6tcb 6wfm 6wfv 6wgy 6y01 7dio 7jt8 7nr2 7nrr 7p5r 7qeh 7t7j 7tjl

SHELXL

5zgl

SHELXL-92

1jbc

SHELXL-93

1a2p 1aa5 1aqb 1bpi 1cex 1dfx 1irn 1iro 1jer 1jhg 1joh 1jse 1jsf 1lkk 1lks 1nfn 1nfo 1nkd 1pch 1rge 1rgf 1rgg 1rgh 1rhs 1wad 1yna 2cth 2erl

SHELXL-96

1a3l 1a7s 1hjt 1ixg 1ixh 1jdo 1lpi 1pcz 1sfp 1swa 1swc 1swd 1swe 1swf 2igd 3lzt 4lzt

SHELXL-97

1a6g 1a6n 1a7y 1a7z 1a8d 1al4 1alq 1alx 1alz 1ar2 1av2 1awd 1ayo 1b0b 1b6g 1bl8 1bq6 1btu 1buo 1bx7 1byi 1c5e 1co8 1co9 1cp0 1cp5 1cpw 1f0p 1i40 1j8q 1j9e 1lb3 1mun 1muy 1nls 1nse 1p8h 1p8i 1p8u 1po7 1psr 1q6z 1qh4 1rb9 1rcf 1rxg 1swg 1swh 1swj 1swk 1swl 1swn 1swo 1swp 1swq 1swr 1tl2 2ei4 2eug 2gve 2inq 2yas 2z12 2z18 2z19 3eug 3psr 3seb 4iro

SHELXT

5zgl

SIGMAA

1b3n 1eay 1fo4 1igv 1qgt 2ca5 4b4p

SIR2002

1swz 2anv

SOLOMON

2jaa 2w80 2w81 2yor

SOLVE

1e8x 4tv7 4u6k 4u6l

SOMORE

1q45

STARTING

1i70 1i8v

Sca2Structure

2hpv 2hq4 2idg 2iel

Shake

1n2d 1spv 3psm

Single

4o41

Starting

1lni 3sky

Superflip

4f7o

TEXTAL

1hkw

TF

1ng0

TFFC

1a9w 1ah8 1ahw 1aup 1b4e 1igw 1k89 1qtj 1sgf 1zfp 2bcc 3bcc 3h1i

TNT/CCP4

1biq

TRANSF

1c8e 1c8f 1c8g

TRIVIAL

6fd1 6fdr 7fd1 7fdr

TRUNCATE

1pp9

TSFGEN

1il2

ULTIMA

1ilc 1ndn 1qp5 1vte 1xjx 1xjy 308d 330d 423d 424d 425d

UNPUBLISHED

1bu6 1f3z 1glf 2f3g

VARIOUS

1atg

VECREF

1ah6 1ao7 1b1c 1qfe

VECSUM

1ah6 1aw5 5eas

VERIFY

6cro

WARP

1bqc 1czf 1dlw 1elv 1fj2 1ga1 1hzt 1ixk 1ixl 1j6z 1m7j 1mkz 1mo9 1qad 1qah 1qio 1qus 1tt6 1tz8 1vlq 2rdy 3bqv 3brp 3df7 3dmy 3ewn 3f5d 3fg9 3fij 3gnj 3hcz 3hdj 3hmq 3i8n 3ic9 3ica 3ikb 3ilk 3ius 3iv4 3ivp 3jrk 3jyf 3kbr 3kkb 3kyz 3kzd 3kze 3l1w 3lae 3lag 3lax 3laz 3ldu 3lhe 3lhh 3loq 3lsg 3lzk 3m1r 3m33 3mn2 3mo4 3mt0 3muq 3mw6 3mz1 3n04 3ne8 3neu 3nyi 3nym 3nze 3o12 3o2i 3ocj 3ocm 3od1 3oi8 3olq 3om8 3on1 3on2 3oon 3ooo 3oop 3oos 3oou 3pmm 3pn8 3pnn 3qao 3qwt 3qz6 3r0v 3rob 3rpc 3rpw 3rq0 3rwp 3sc1 3sg0 3t8k 3tng 4e94 4hc5 4hde 4hku 4hn3 4hx6 4hyl 4i19 4i1d 4i6v 4ipt 4iyh 4j10 4jdu 4jwo 4kt7 4ktb 4kv7 4kvf 4ljs 4llc 4m0g 4m0m 4m7o 4m9u 4nas 4neg 4noc 4npb 4nqr 4o5a 4p0g 4p11 4pys 4pz0 4pzl 4q2b 4q31 4q6t 4q7o 4q7q 4qn8 4r0j 4r7q 4r82 4twe 4w1u 4wky 4xea 4xfk 5k29 5kkp 5l88 5ngl 5noa 5ts8 8deh

X-PLOR

101m 102m 103m 104m 105m 106m 107m 108m 109m 10gs 110m 111m 112m 117e 11ba 11bg 11gs 121p 12as 12e8 12gs 133l 134l 135l 13gs 13pk 16gs 16pk 18gs 1914 193l 194l 19gs 1a02 1a04 1a05 1a06 1a07 1a08 1a09 1a0b 1a0c 1a0d 1a0e 1a0f 1a0g 1a0h 1a0i 1a0k 1a0l 1a0o 1a0q 1a0r 1a0s 1a0t 1a12 1a14 1a15 1a16 1a18 1a1a 1a1b 1a1c 1a1e 1a1f 1a1g 1a1h 1a1i 1a1j 1a1k 1a1l 1a1m 1a1n 1a1o 1a1q 1a1x 1a21 1a22 1a26 1a29 1a2a 1a2b 1a2c 1a2d 1a2f 1a2g 1a2j 1a2l 1a2m 1a2n 1a2o 1a2p 1a2t 1a2u 1a2v 1a2w 1a2x 1a2y 1a30 1a32 1a33 1a35 1a36 1a37 1a38 1a3a 1a3c 1a3d 1a3f 1a3g 1a3i 1a3j 1a3k 1a3r 1a3t 1a3u 1a3v 1a3w 1a3y 1a3z 1a40 1a41 1a42 1a43 1a45 1a4a 1a4c 1a4e 1a4g 1a4h 1a4j 1a4l 1a4m 1a4q 1a4r 1a4u 1a4v 1a4x 1a4y 1a4z 1a50 1a53 1a58 1a59 1a5a 1a5b 1a5c 1a5d 1a5f 1a5h 1a5i 1a5k 1a5l 1a5m 1a5n 1a5o 1a5p 1a5q 1a5s 1a5t 1a5v 1a5w 1a5x 1a5z 1a62 1a64 1a68 1a6e 1a6f 1a6i 1a6j 1a6l 1a6p 1a6r 1a6t 1a71 1a72 1a75 1a76 1a77 1a78 1a7b 1a7c 1a7d 1a7e 1a7g 1a7j 1a7k 1a7l 1a7v 1a81 1a82 1a8g 1a8j 1a8k 1a8l 1a8m 1a8o 1a8p 1a8r 1a8z 1a92 1a95 1a96 1a97 1a98 1a99 1a9b 1a9c 1a9e 1a9m 1a9o 1a9p 1a9q 1a9r 1a9s 1a9t 1aa0 1aa1 1aa7 1aac 1aaj 1aam 1aan 1aaq 1aar 1aaw 1aax 1aay 1aaz 1ab0 1ab4 1ab8 1ab9 1aba 1abb 1abo 1abq 1abr 1abs 1abw 1ac1 1ac5 1acc 1acd 1acf 1acj 1acl 1aco 1acv 1acy 1ad0 1ad2 1ad5 1ad8 1ad9 1adb 1adc 1add 1ade 1adf 1adg 1adj 1adl 1ado 1ads 1adu 1adv 1adw 1ady 1ae2 1ae3 1ae4 1ae6 1ae7 1ae9 1aec 1aei 1aer 1aex 1af0 1af2 1af4 1af5 1af9 1afa 1afb 1afc 1afd 1afl 1afq 1afr 1afs 1afu 1afv 1ag0 1ag8 1ag9 1agb 1agc 1agd 1age 1agf 1agi 1agj 1agp 1agr 1ags 1agw 1agx 1agy 1ah0 1ah3 1ah4 1ah6 1ah8 1aha 1ahb 1ahc 1ahh 1ahi 1ahn 1ahp 1ahq 1ahr 1ahs 1aht 1ahw 1ai1 1ai3 1aia 1aib 1aic 1aid 1aie 1aik 1aim 1ain 1aip 1air 1ais 1aiu 1aiv 1aj2 1aj5 1aj8 1aj9 1aja 1ajb 1ajc 1ajd 1ajg 1ajh 1ajj 1ajv 1ajx 1ajz 1ak0 1ak1 1ak2 1ak4 1akd 1ake 1akg 1akh 1aki 1akl 1akn 1ako 1aky 1al0 1al2 1al7 1alb 1alh 1ali 1alj 1alk 1all 1aln 1alq 1aly 1am1 1am2 1am5 1am6 1am7 1ame 1amf 1amh 1ami 1amj 1amn 1amo 1amp 1amq 1amr 1ams 1amu 1amw 1amx 1amy 1an0 1an4 1an5 1an7 1an9 1ang 1ani 1anj 1ank 1ann 1ant 1ao0 1ao3 1ao5 1ao6 1ao7 1aoa 1aob 1aoc 1aod 1aof 1aog 1aoh 1aol 1aom 1aon 1aop 1aoq 1aor 1aos 1aov 1aow 1aox 1aoz 1ap2 1ap5 1ap9 1apa 1apm 1apn 1apx 1aq0 1aq2 1aq7 1aq8 1aqb 1aqc 1aqd 1aqh 1aqk 1aql 1aqp 1aqt 1aqu 1aqy 1aqz 1ar1 1ar4 1ar5 1ar6 1ar7 1ar8 1ar9 1aro 1arp 1ars 1art 1aru 1arv 1arw 1arx 1ary 1arz 1as0 1as2 1as3 1as4 1as6 1as7 1as8 1asa 1asb 1asc 1asd 1ase 1asf 1asg 1ash 1asj 1asl 1asm 1asn 1aso 1asp 1asq 1ast 1asx 1asy 1asz 1at0 1at3 1at5 1at6 1at9 1ath 1ati 1atj 1atk 1atl 1atp 1atr 1ats 1att 1atu 1au0 1au1 1au2 1au3 1au4 1au8 1auc 1auj 1auk 1aum 1aun 1auo 1auq 1aur 1aus 1auw 1aux 1av1 1av4 1av5 1av7 1av8 1ava 1avb 1avc 1avf 1avl 1avm 1avo 1avt 1avu 1avw 1avx 1avy 1avz 1aw7 1aw8 1awb 1awf 1awh 1awp 1aws 1awt 1awu 1ax0 1ax1 1ax2 1axb 1axc 1axe 1axg 1axi 1axq 1axr 1axs 1axw 1axy 1axz 1ay0 1ay2 1ay4 1ay5 1ay6 1ay8 1ay9 1aya 1ayb 1ayc 1ayd 1aye 1aym 1ayn 1ayp 1ayr 1ayu 1ayv 1ayw 1az0 1az1 1az2 1az3 1az4 1az5 1az8 1azd 1azf 1azn 1azo 1azq 1azr 1azs 1azv 1azw 1azy 1azz 1b06 1b09 1b0e 1b0j 1b0k 1b0m 1b0r 1b0t 1b11 1b14 1b15 1b16 1b17 1b18 1b19 1b1y 1b20 1b21 1b26 1b27 1b2b 1b2c 1b2d 1b2e 1b2f 1b2g 1b2l 1b2u 1b2w 1b2x 1b2z 1b30 1b31 1b3b 1b3d 1b3o 1b3r 1b3s 1b3t 1b3v 1b3w 1b3x 1b3y 1b3z 1b42 1b4a 1b4b 1b4j 1b4l 1b4s 1b4x 1b54 1b56 1b5o 1b5p 1b5u 1b5v 1b5w 1b5x 1b5y 1b5z 1b66 1b68 1b6e 1b6j 1b6k 1b6l 1b6m 1b6p 1b6q 1b70 1b76 1b7i 1b7j 1b7k 1b7l 1b7m 1b7n 1b7o 1b7p 1b7q 1b7r 1b7s 1b7y 1b8c 1b8d 1b8j 1b8n 1b8o 1b8p 1b8r 1b8u 1b8v 1b9e 1b9o 1b9s 1b9t 1b9v 1ba0 1ba1 1ba2 1ba3 1ba7 1ba8 1baf 1bai 1bam 1ban 1bao 1bar 1bas 1baw 1bay 1baz 1bb0 1bb1 1bb3 1bbc 1bbh 1bbt 1bc0 1bc1 1bc2 1bc3 1bc5 1bcf 1bck 1bcm 1bco 1bcu 1bcw 1bcx 1bcy 1bcz 1bd0 1bd2 1bd7 1bda 1bdf 1bdj 1bdl 1bdo 1bdq 1bdr 1bdt 1bdu 1bdv 1bdy 1be0 1be6 1be8 1be9 1bea 1beb 1bec 1bed 1bee 1beo 1bet 1beu 1bev 1bex 1bez 1bf2 1bf3 1bf6 1bfa 1bfb 1bfc 1bfe 1bfn 1bfo 1bfs 1bft 1bfu 1bg0 1bg2 1bg3 1bg4 1bg7 1bg8 1bg9 1bga 1bgb 1bgc 1bgd 1bge 1bgf 1bgg 1bgi 1bgj 1bgn 1bgo 1bgp 1bgq 1bgs 1bgt 1bgu 1bgx 1bh0 1bhc 1bhe 1bhf 1bhh 1bhj 1bhl 1bht 1bhw 1bhx 1bhy 1bhz 1bi0 1bi1 1bi2 1bi3 1bi4 1bi7 1bi8 1bid 1bif 1bij 1bik 1bil 1bim 1bin 1bir 1bis 1bit 1biu 1biw 1bix 1biz 1bj1 1bj5 1bj7 1bja 1bjf 1bjg 1bji 1bjj 1bjm 1bjn 1bjo 1bjp 1bjq 1bjt 1bju 1bjv 1bjw 1bjz 1bk1 1bk2 1bk9 1bke 1bkf 1bkg 1bkh 1bkj 1bkl 1bkm 1bko 1bkp 1bkw 1bkx 1bky 1bkz 1bl3 1bl5 1bl9 1blb 1ble 1bli 1bll 1bln 1bm0 1bm1 1bma 1bmd 1bmg 1bmm 1bmn 1bmo 1bmp 1bmq 1bms 1bmt 1bn1 1bn3 1bn4 1bnd 1bnl 1bnm 1bnn 1bnq 1bnt 1bnu 1bnv 1bnw 1bo6 1bo7 1bo8 1bob 1bof 1boi 1boq 1bos 1bou 1bp0 1bp1 1bp3 1bp4 1bp6 1bpj 1bpl 1bpq 1bpt 1bq1 1bq2 1bq3 1bq4 1bq7 1bqi 1bqj 1bql 1bqm 1bqn 1bqo 1bqp 1bqy 1br1 1br2 1br5 1br6 1brb 1brc 1bre 1brg 1brm 1brp 1brq 1brr 1brw 1brx 1bry 1bs3 1bs4 1bs5 1bs6 1bs7 1bs8 1bsf 1bsg 1bsj 1bsk 1bsm 1bsp 1bsr 1bss 1bsu 1bsw 1bsy 1bsz 1bt4 1bt8 1btc 1bth 1bti 1btk 1btl 1btm 1btn 1btp 1btu 1btw 1btx 1bty 1btz 1bu3 1bu7 1bua 1buc 1bud 1bue 1bun 1bup 1buu 1buw 1bux 1bv1 1bv4 1bvb 1bvc 1bvd 1bvi 1bvk 1bvl 1bvo 1bvp 1bvr 1bvt 1bvv 1bwk 1bwl 1bx0 1bx1 1bx6 1bxa 1bxb 1bxc 1bxm 1bxu 1by8 1bya 1byb 1byc 1byd 1byh 1byi 1bz1 1bz4 1bz7 1bz8 1bza 1bzd 1bze 1bzl 1bzs 1bzw 1bzx 1bzy 1bzz 1c09 1c0k 1c0t 1c0u 1c14 1c1b 1c1c 1c1h 1c1n 1c1o 1c1p 1c1q 1c1r 1c1s 1c1t 1c1u 1c1v 1c1w 1c25 1c29 1c2d 1c2e 1c2f 1c2g 1c2h 1c2i 1c2j 1c2k 1c2l 1c2m 1c39 1c3b 1c3d 1c3f 1c3v 1c47 1c4g 1c4k 1c4t 1c4u 1c4v 1c4w 1c4y 1c50 1c52 1c5d 1c5g 1c5h 1c5i 1c5l 1c5m 1c5n 1c5o 1c5p 1c5q 1c5r 1c5s 1c5t 1c5u 1c5v 1c5w 1c5x 1c5y 1c5z 1c74 1c7g 1c7h 1c7z 1c80 1c81 1c82 1c8i 1c8k 1c8l 1c8v 1c8y 1c92 1c93 1c96 1c97 1c9c 1c9d 1c9e 1c9h 1ca0 1ca1 1ca5 1ca6 1ca8 1caa 1cad 1cag 1cb7 1cbg 1cbi 1cbq 1cbr 1cbs 1cbw 1cby 1cc3 1cc4 1cc6 1cca 1ccb 1ccc 1ccd 1cce 1ccg 1cci 1ccj 1cck 1ccl 1cd1 1cd5 1cd8 1cdc 1cdd 1cde 1cdh 1cdi 1cdk 1cdl 1cdo 1cdw 1cdz 1cec 1cef 1ceg 1ceh 1cel 1cen 1ceo 1cer 1cf0 1cfb 1cfr 1cfy 1cg0 1cg1 1cg2 1cg3 1cg4 1cg5 1cg6 1cg8 1cge 1cgf 1cgh 1cgl 1cgm 1cgs 1cgt 1cgu 1ch2 1ch8 1chd 1chk 1chn 1chp 1chq 1chz 1ci6 1ci7 1cib 1cii 1cil 1cim 1cin 1cip 1cit 1ciw 1ciy 1cj2 1cj3 1cj4 1cj6 1cj7 1cj8 1cj9 1cjf 1cjl 1cjm 1cjp 1cjs 1ck3 1ck6 1cka 1ckb 1ckc 1ckd 1ckf 1ckh 1cki 1ckj 1ckm 1cks 1ckt 1cl0 1cl1 1cl2 1cl6 1cl8 1clc 1cle 1clk 1clm 1clp 1clw 1cm1 1cm4 1cmj 1cmk 1cmp 1cmq 1cmt 1cmu 1cn0 1cne 1cnf 1cng 1cnh 1cni 1cnj 1cnk 1cno 1cns 1cnt 1cnv 1co7 1co8 1co9 1cof 1coi 1com 1con 1cos 1cov 1coy 1cp0 1cp2 1cp5 1cpe 1cpg 1cpi 1cpj 1cpm 1cpn 1cpr 1cpt 1cpw 1cq1 1cq2 1cq6 1cq7 1cq8 1cqa 1cqp 1cqq 1cqs 1cqy 1cr1 1cr2 1cr4 1cr6 1crb 1crk 1crl 1crw 1cry 1csb 1csg 1csk 1csm 1csn 1cso 1csq 1ct0 1ct1 1ct2 1ct4 1cte 1ctm 1ctn 1ctq 1ctr 1ctt 1ctu 1cu1 1cua 1cub 1cuc 1cud 1cue 1cuf 1cug 1cuh 1cui 1cuj 1cus 1cuu 1cuv 1cuw 1cux 1cuy 1cuz 1cvm 1cvn 1cvu 1cw1 1cw2 1cw4 1cw7 1cwa 1cwb 1cwc 1cwf 1cwh 1cwi 1cwj 1cwk 1cwl 1cwm 1cwo 1cx9 1cxa 1cxc 1cxp 1cxq 1cxu 1cy1 1cy2 1cy6 1cy8 1cy9 1cyd 1cyi 1cyj 1cyn 1cyo 1cyq 1cyw 1cyx 1cz0 1cz8 1cz9 1czb 1czc 1cze 1czh 1czj 1czk 1czl 1czn 1czo 1czr 1czu 1d03 1d04 1d09 1d0c 1d0k 1d0l 1d0m 1d0o 1d1s 1d1t 1d2c 1d2g 1d2h 1d2k 1d2v 1d3p 1d3q 1d3t 1d3w 1d4f 1d4k 1d4l 1d4m 1d4x 1d5d 1d5e 1d5h 1d5j 1d5l 1d5n 1d6a 1d6n 1d6o 1d6p 1d6q 1d6w 1d7a 1d7f 1d7h 1d7i 1d7j 1d7w 1d7x 1d8d 1d8e 1d8f 1d8m 1d8t 1d8x 1d9i 1d9u 1daa 1dad 1dae 1daf 1dag 1dah 1dai 1dan 1dar 1dat 1db4 1db5 1dba 1dbb 1dbj 1dbk 1dbm 1dbp 1dbs 1dbv 1dc1 1dc4 1dc5 1dc6 1dcr 1dcy 1dd7 1dd8 1ddl 1ddr 1dds 1ddt 1ddu 1ddx 1de0 1dea 1ded 1deg 1deh 1dei 1df1 1df8 1dfa 1dfb 1dff 1dfj 1dfp 1dg1 1dgb 1dgl 1dhn 1dhp 1dhr 1dhs 1dht 1dhy 1di3 1di5 1dic 1dif 1dih 1dii 1dik 1dil 1dim 1diq 1dir 1div 1dj6 1dj9 1dja 1djb 1djc 1dje 1dkg 1dkj 1dkk 1dks 1dkt 1dku 1dkx 1dky 1dkz 1dla 1dlc 1dlf 1dlh 1dlo 1dm2 1dm5 1dmi 1dmj 1dmk 1dmm 1dmn 1dmp 1dmq 1dms 1dna 1dnc 1dno 1dnp 1dnt 1dnu 1dnv 1dnw 1dnx 1dnz 1dob 1doc 1dod 1doe 1doi 1dor 1dos 1dot 1dou 1dp2 1dp6 1dp8 1dp9 1dpb 1dpc 1dpd 1dpe 1dpg 1dpp 1dpr 1dps 1dpt 1dpz 1dq0 1dq1 1dqk 1dr0 1dr8 1drj 1drk 1ds2 1ds7 1dsb 1dsf 1dsl 1dss 1dsu 1dtg 1dth 1dti 1dtn 1dtp 1dtq 1dts 1dtt 1du0 1du5 1dud 1dut 1dvf 1dvi 1dvl 1dvm 1dvn 1dvr 1dxy 1dyn 1e2a 1e2o 1eaa 1eab 1eac 1ead 1eae 1eaf 1eah 1eam 1eap 1eas 1eat 1eau 1ebd 1ebh 1ebp 1ebv 1ebw 1eby 1ebz 1ec0 1ec1 1ec2 1ec3 1ecb 1ecc 1ece 1ecf 1ecg 1ecj 1ecl 1ecm 1ecp 1ecs 1ecy 1ecz 1ed5 1ed8 1ed9 1edg 1edm 1edn 1edt 1eea 1eem 1eet 1ef3 1efg 1efn 1efp 1eft 1efu 1efz 1eg3 1egc 1egd 1ege 1egh 1egy 1ehe 1ehf 1ehg 1ehh 1ehl 1ehv 1ei7 1eic 1eid 1eie 1eif 1eiy 1ej7 1ek1 1ek2 1ekl 1eko 1el3 1ela 1elb 1elc 1eld 1ele 1elf 1elg 1elo 1elt 1elx 1ely 1elz 1emc 1emd 1eme 1emf 1emm 1emr 1emy 1en3 1en8 1en9 1ena 1enc 1ene 1enh 1enn 1enq 1enr 1ens 1enu 1env 1enx 1eny 1enz 1eo3 1eo4 1eoj 1eol 1eon 1eoo 1eop 1eos 1eow 1ep2 1ep4 1epa 1epb 1ept 1eq4 1eq5 1eqa 1eqd 1eqe 1eqv 1eqy 1erk 1ert 1eru 1erv 1erw 1erx 1es1 1esa 1esb 1esc 1esf 1esl 1esm 1esp 1esu 1esv 1eth 1etj 1eto 1etp 1etq 1etr 1ets 1ett 1etv 1etw 1etx 1euh 1eui 1euo 1eup 1euq 1eur 1eus 1eut 1euu 1euy 1euz 1ev1 1eve 1evi 1evp 1evu 1ew0 1ew8 1ew9 1ewd 1ewe 1ewf 1ewj 1ex5 1ex7 1exf 1exm 1exn 1exp 1ext 1exv 1eyu 1ez4 1ez9 1ezl 1ezm 1f06 1f0o 1f0r 1f0w 1f10 1f13 1f18 1f1a 1f1b 1f1d 1f1h 1f24 1f25 1f26 1f2b 1f2c 1f2m 1f2s 1f2y 1f2z 1f3e 1f3w 1f3x 1f52 1f58 1f5z 1f69 1f6k 1f6p 1f73 1f74 1f7b 1f7k 1f7n 1f86 1f8b 1f8c 1f8d 1f8e 1f8q 1f8t 1f8v 1f8w 1f8y 1f90 1f9c 1f9g 1f9o 1f9t 1f9u 1f9v 1f9w 1fa9 1fae 1fah 1faj 1fan 1fap 1fas 1fat 1fax 1fba 1fbc 1fbd 1fbe 1fbf 1fbg 1fbh 1fbi 1fbl 1fbo 1fbt 1fbw 1fbz 1fca 1fcc 1fcd 1fce 1fda 1fdb 1fdd 1fdi 1fdj 1fdk 1fdn 1fdo 1fdp 1fdq 1fdr 1fds 1fdt 1fdy 1fdz 1fe3 1fea 1feb 1fec 1fer 1fev 1ff2 1ffa 1ffb 1ffc 1ffd 1ffe 1ffh 1fgb 1fgh 1fgi 1fgj 1fgl 1fgn 1fgv 1fh2 1fhe 1fhh 1fhi 1fhm 1fhn 1fhz 1fib 1fic 1fid 1fie 1fig 1fik 1fil 1fim 1fip 1fit 1fiv 1fj6 1fj9 1fjm 1fjs 1fk0 1fk1 1fk2 1fk3 1fk4 1fk5 1fk6 1fk7 1fkb 1fkg 1fkh 1fki 1fkj 1fkk 1fkl 1fkq 1fkv 1fkw 1fkx 1fla 1fld 1flj 1fln 1flp 1flq 1flt 1flu 1flv 1flw 1fly 1fm9 1fmb 1fmc 1fmd 1fmg 1fmk 1fmo 1fmq 1fms 1fmt 1fn3 1fn5 1fn6 1fnf 1fni 1fnj 1fnk 1fnu 1fnv 1fnw 1fny 1fnz 1fod 1foj 1fok 1fon 1for 1fpb 1fpd 1fpe 1fpf 1fpg 1fpi 1fpj 1fpk 1fpl 1fpn 1fps 1fpt 1fpy 1fqc 1fqd 1fql 1fqm 1fqn 1fqo 1fqr 1fr5 1frb 1frg 1frh 1fri 1frj 1frk 1frl 1frm 1fro 1frp 1frq 1frs 1frt 1frv 1frx 1fs3 1fs6 1fsa 1fsc 1fsn 1fsq 1fsr 1fss 1fsu 1ft1 1ft2 1ft7 1fta 1ftc 1ftd 1ftg 1ftk 1ftm 1fua 1fug 1fui 1fun 1fuo 1fup 1fuq 1fur 1fuy 1fvc 1fvd 1fve 1fvj 1fvk 1fvp 1fvt 1fvx 1fw2 1fwa 1fwb 1fwc 1fwd 1fwe 1fwf 1fwg 1fwh 1fwi 1fwj 1fxr 1fxy 1fy8 1fyh 1fym 1fyn 1fzb 1fzc 1fzd 1fze 1fzf 1fzg 1fzz 1g05 1g0u 1g1d 1g1o 1g1y 1g2m 1g2u 1g30 1g31 1g32 1g36 1g37 1g3o 1g3z 1g45 1g46 1g48 1g4a 1g4b 1g4j 1g4o 1g4v 1g4x 1g52 1g53 1g54 1g5g 1g5s 1g65 1g6b 1g6n 1g7g 1g7n 1g7w 1g7x 1g86 1g94 1g9f 1g9h 1g9i 1g9s 1g9t 1g9v 1gad 1gae 1gaf 1gah 1gai 1gal 1gam 1gan 1gar 1gav 1gba 1gbb 1gbc 1gbd 1gbe 1gbf 1gbh 1gbi 1gbj 1gbk 1gbl 1gbm 1gbn 1gbs 1gc1 1gc8 1gc9 1gca 1gcb 1gce 1gcg 1gcl 1gcm 1gcv 1gcw 1gcy 1gcz 1gd0 1gdd 1gde 1gdh 1gdr 1gdv 1gdw 1gdx 1ge0 1ge1 1ge2 1ge3 1ge4 1geb 1gec 1ged 1gei 1gej 1gek 1gem 1gen 1ger 1ges 1get 1geu 1gev 1gez 1gf0 1gf3 1gf4 1gf5 1gf6 1gf7 1gf8 1gf9 1gfa 1gfe 1gfg 1gfh 1gfi 1gfj 1gfk 1gfl 1gfm 1gfn 1gfo 1gfp 1gfq 1gfr 1gfs 1gft 1gfu 1gfv 1gfz 1gg2 1ggb 1ggc 1ggi 1ggm 1ggt 1ggu 1ggv 1ggy 1ghb 1ghf 1ghl 1ghr 1ghs 1gia 1gic 1gif 1gig 1gil 1gim 1gin 1git 1gke 1gkh 1gla 1glb 1glj 1gln 1glp 1glq 1gmk 1gnd 1gne 1gnh 1gnp 1gnq 1gnr 1gnw 1got 1gow 1gp2 1gph 1gpl 1gpm 1gpo 1gpy 1grc 1gri 1grj 1grl 1gro 1grp 1grt 1gsa 1gsd 1gse 1gsf 1gsh 1gsl 1gsn 1gsp 1gss 1gsu 1gsy 1gta 1gtb 1gti 1gto 1gtp 1gtq 1gtr 1gtu 1gua 1guh 1guk 1gux 1gvp 1gyl 1gym 1gyp 1gza 1gzb 1h2a 1h4n 1h9n 1h9q 1ha1 1hag 1hah 1hai 1han 1har 1hav 1hbh 1hbi 1hbp 1hbq 1hbr 1hbt 1hbv 1hcg 1hck 1hcl 1hcn 1hda 1hde 1hdg 1hdr 1hdt 1hdx 1hdy 1hdz 1hei 1hex 1hey 1hfc 1hfd 1hfs 1hfx 1hfy 1hfz 1hgd 1hge 1hgf 1hgg 1hgh 1hgi 1hgj 1hgu 1hhg 1hhh 1hhi 1hhj 1hhk 1hhl 1hhp 1hib 1hih 1hii 1hij 1hik 1hil 1him 1hin 1hiw 1hja 1hjk 1hjp 1hjr 1hjt 1hkb 1hkc 1hkl 1hlb 1hlc 1hld 1hle 1hlm 1hlp 1hlt 1hlu 1hm6 1hmc 1hmk 1hml 1hmp 1hmr 1hms 1hmt 1hmv 1hmy 1hna 1hnb 1hnc 1hnf 1hng 1hni 1hnv 1hny 1hoc 1hon 1hoo 1hop 1hor 1hot 1hpb 1hpc 1hpg 1hpl 1hpm 1hps 1hpt 1hpv 1hpx 1hpz 1hq6 1hqa 1hqe 1hqs 1hqu 1hqz 1hrn 1hrp 1hrs 1hsa 1hsb 1hsg 1hsh 1hsi 1hsl 1hsr 1hss 1hst 1hsw 1hsx 1htb 1htd 1htf 1htg 1hti 1htl 1htm 1hto 1htp 1htq 1htt 1hu9 1huc 1huk 1hul 1huo 1hup 1hur 1hus 1huu 1huw 1huz 1hv0 1hv1 1hv4 1hva 1hvc 1hvd 1hve 1hvf 1hvg 1hvh 1hvi 1hvj 1hvk 1hvl 1hvq 1hvr 1hvs 1hvx 1hwg 1hwh 1hwm 1hwn 1hwp 1hwr 1hwy 1hxb 1hxw 1hye 1hyl 1hyp 1hys 1i1q 1i2z 1i4y 1i4z 1i54 1i55 1i5o 1i73 1i75 1i76 1i7e 1i8m 1i8z 1i90 1i91 1i9l 1i9m 1i9n 1i9o 1i9p 1i9q 1iaa 1iab 1iac 1iad 1iae 1iag 1iai 1iak 1ial 1iam 1ian 1ibc 1ibg 1ibs 1ibt 1ibu 1ibv 1ibw 1ic1 1ice 1icj 1icm 1icn 1ict 1icw 1id5 1ida 1idb 1idc 1idd 1ide 1idf 1idj 1idk 1ido 1idp 1idt 1ie4 1iea 1ieb 1ier 1iev 1if4 1if5 1if6 1if7 1if8 1if9 1ifa 1ifc 1ifg 1ifh 1ifp 1ifs 1ift 1ifu 1igb 1igc 1igd 1igs 1igt 1igy 1ihp 1ihs 1iht 1iib 1ik3 1ik4 1ika 1ikf 1il1 1il3 1il4 1il5 1il9 1ile 1ilk 1ilr 1ils 1ilt 1ilu 1ima 1imb 1imc 1imd 1ime 1imf 1ind 1ine 1inf 1ing 1inh 1inp 1inr 1inu 1inv 1inw 1inx 1iny 1io5 1io8 1io9 1ioa 1ioc 1iof 1ioi 1iok 1iol 1iop 1ioq 1ior 1ios 1iot 1iow 1ipe 1ipf 1iph 1ipj 1ipw 1iqb 1iqw 1iqx 1iqy 1ir7 1ir8 1ir9 1ira 1irb 1ird 1irk 1iru 1isa 1isc 1iso 1ist 1it2 1it3 1it9 1itb 1itg 1ith 1itt 1itu 1iu7 1iud 1ius 1iut 1iuu 1iuv 1iuw 1iux 1iuz 1iv2 1iv3 1iv4 1iv7 1iv9 1ivb 1ivc 1ivd 1ive 1ivf 1ivg 1ivh 1ivl 1ivu 1ivv 1ivw 1ivx 1ivy 1iwi 1iwj 1iwk 1iwo 1ix6 1ix7 1ix8 1ixi 1ixx 1iyh 1j0y 1j0z 1j10 1j11 1j12 1j1b 1j5o 1j73 1j7z 1j80 1j81 1j82 1jab 1jae 1jah 1jai 1jan 1jao 1jap 1jaq 1jaw 1jbp 1jca 1jck 1jcq 1jcr 1jcs 1jcv 1jd2 1jd9 1jda 1jdc 1jdd 1jde 1jdo 1jdw 1jdx 1jdy 1jef 1jf3 1jf4 1jfb 1jfc 1jfh 1jfq 1jgg 1jgj 1jhl 1jhw 1ji6 1jia 1jie 1jif 1jii 1jij 1jik 1jir 1jk1 1jk2 1jka 1jkb 1jkc 1jkd 1jkw 1jl6 1jl7 1jld 1jlm 1jlu 1jlx 1jly 1jmf 1jmg 1jmh 1jmi 1jmw 1jmz 1jn1 1jnk 1jnq 1joa 1joi 1jon 1jot 1jpc 1jph 1jpi 1jpk 1jpo 1jpq 1jrh 1jrn 1jrp 1jrs 1jrt 1js4 1jse 1jsf 1jsg 1jsw 1jsz 1jte 1jtf 1jtq 1jtu 1jug 1juk 1jul 1juy 1jv6 1jv7 1jvt 1jvu 1jvv 1jw6 1jwr 1jwt 1jxe 1jxp 1jyb 1jyl 1jza 1jzf 1jzg 1jzh 1jzi 1k06 1k08 1k0f 1k0u 1k0y 1k1e 1k1k 1k4g 1k4h 1k4q 1k5m 1k6m 1k7t 1k7u 1k7v 1k8f 1k8i 1k9b 1kaa 1kab 1kao 1kap 1kaw 1kax 1kay 1kaz 1kb3 1kba 1kbg 1kbp 1kce 1kct 1kcw 1kda 1kdb 1kdc 1kdj 1kdn 1kds 1kdw 1ke0 1ke3 1ke5 1ke6 1ke7 1ke8 1ke9 1keg 1kek 1kel 1kem 1kf9 1kfs 1kge 1kgf 1kgu 1kgw 1kgx 1kh5 1kh7 1kh8 1kh9 1khj 1khk 1khl 1khn 1khr 1kig 1kip 1kiq 1kir 1kix 1kjx 1kk4 1kk5 1kkb 1kkf 1klm 1klo 1klt 1kmb 1kmm 1kmn 1knb 1kno 1knt 1koa 1kob 1koe 1kop 1koq 1kp4 1kpa 1kpb 1kpc 1kpe 1kpf 1kpt 1kq7 1kqa 1kqj 1kqu 1kra 1krb 1krc 1krj 1krn 1krp 1kru 1krv 1ksp 1ksz 1kte 1ktq 1kts 1kva 1kvb 1kvc 1kvd 1kve 1kvo 1kvw 1kvx 1kvy 1kwq 1kxa 1kxb 1kxc 1kxd 1kxe 1kxf 1kxh 1kxi 1kxu 1kxw 1kxx 1kxy 1ky4 1ky5 1kza 1kzb 1kzc 1kzd 1kze 1kzo 1kzp 1kzu 1l0p 1l1f 1l2k 1l5g 1l5t 1l6b 1l6f 1l6g 1la6 1laa 1laf 1lag 1lah 1laj 1lam 1lan 1lay 1lba 1lbe 1lbf 1lbh 1lbi 1lbl 1lbm 1lbs 1lbt 1lca 1lcb 1lce 1lci 1lcj 1lck 1lcl 1lco 1lcp 1ldc 1ldg 1ldn 1ldp 1ldt 1lec 1led 1leg 1lem 1leo 1lep 1les 1lfa 1lfb 1lfo 1lg5 1lg6 1lga 1lgb 1lgc 1lgd 1lgh 1lgn 1lgr 1lgy 1lhs 1lht 1lia 1lib 1lic 1lid 1lie 1lif 1lih 1lil 1lin 1lis 1lit 1ljn 1ljr 1ljt 1lkf 1lki 1lkl 1lkr 1lkt 1ll1 1ll6 1ll7 1lla 1llm 1lln 1llp 1lmk 1lml 1lmt 1lmw 1ln1 1lnh 1loa 1lob 1loc 1lod 1loe 1lof 1log 1loh 1lop 1lox 1loz 1lp8 1lpa 1lpb 1lpc 1lpd 1lpf 1lpg 1lph 1lpk 1lpm 1lpn 1lpo 1lpp 1lps 1lpz 1lqd 1lqe 1lr4 1lrv 1ls1 1lsa 1lsb 1lsc 1lsd 1lse 1lsf 1lsg 1lsq 1lst 1lsv 1lsw 1lsx 1lsy 1lsz 1lt0 1lt3 1lt4 1lt5 1lta 1ltb 1ltd 1lte 1ltg 1lth 1lti 1ltm 1lts 1ltt 1ltw 1lu2 1lul 1lve 1lw0 1lwb 1lwi 1lwn 1lwo 1lwx 1lx6 1lxa 1lxd 1lxk 1lxm 1lxt 1lya 1lyb 1lyl 1lyn 1lyo 1lys 1lyw 1lyy 1lzy 1m1c 1m1u 1m1x 1m20 1m59 1m6f 1m6p 1m9c 1m9d 1m9e 1m9f 1m9p 1m9x 1m9y 1maa 1mah 1mai 1mal 1mar 1mas 1max 1may 1maz 1mbb 1mbt 1mc8 1mcb 1mcc 1mce 1mcf 1mch 1mci 1mcj 1mck 1mcl 1mcn 1mco 1mcq 1mcr 1mcs 1mct 1mcy 1mdp 1mdq 1mdr 1mdv 1meg 1mel 1mem 1mer 1mes 1met 1meu 1mf2 1mfa 1mfb 1mfc 1mfd 1mfe 1mff 1mfr 1mg1 1mgn 1mhc 1mhd 1mhe 1mhl 1mho 1mhy 1mhz 1mif 1mik 1mil 1mio 1mir 1mjc 1mjk 1mka 1mkb 1mkp 1mks 1mkt 1mku 1mkv 1mkw 1mkx 1ml1 1mla 1mld 1mlf 1mlg 1mlh 1mlj 1mlk 1mll 1mlm 1mln 1mlo 1mlq 1mlr 1mls 1mlu 1mmb 1mmo 1mmp 1mmq 1mmr 1mn1 1mn2 1mnc 1mng 1mnp 1mns 1moa 1mob 1moc 1mod 1mol 1mom 1mpa 1mpb 1mpc 1mpd 1mpf 1mpm 1mpn 1mpo 1mpp 1mpq 1mpr 1mps 1mpt 1mpy 1mq5 1mq6 1mqk 1mrc 1mrd 1mre 1mrf 1mrg 1mrh 1mri 1mrj 1mrk 1mrr 1msa 1msd 1msi 1msj 1msk 1mss 1mst 1mti 1mtj 1mtk 1mtr 1mts 1mtu 1mtv 1mtw 1mty 1muc 1mup 1mva 1mvb 1mwe 1mxa 1mxb 1mxc 1my3 1my4 1myk 1myl 1mym 1myr 1mzl 1mzm 1mzs 1n15 1n1d 1n2c 1n2k 1n2l 1n4e 1n50 1n5c 1n5y 1n6m 1n6q 1n90 1n94 1n95 1n9a 1nag 1nal 1nap 1nas 1nat 1nba 1nbb 1nbc 1nbe 1nbi 1nbv 1nca 1ncb 1ncc 1ncd 1ncf 1ncg 1nch 1nci 1ncl 1nco 1nda 1ndc 1ndh 1ndk 1ndr 1nds 1nej 1nfd 1nfn 1nfo 1nft 1ng1 1nga 1ngb 1ngc 1ngd 1nge 1ngf 1ngg 1ngh 1ngi 1ngj 1ngp 1ngq 1ngs 1nhk 1nhp 1nhq 1nhr 1nhs 1nht 1ni1 1nia 1nib 1nic 1nid 1nie 1nif 1nis 1nit 1nja 1njb 1njc 1njd 1nje 1nkp 1nl4 1nld 1nlk 1nln 1nm1 1nma 1nmb 1nmc 1nmd 1nna 1nnb 1nnc 1nno 1nnt 1noc 1nod 1nof 1noi 1noj 1nok 1nol 1noo 1nos 1nov 1nox 1noz 1np1 1npa 1npk 1npm 1npo 1npw 1npx 1nqb 1ns3 1nsb 1nsc 1nsd 1nsg 1nsj 1nsk 1nsn 1nsp 1nsq 1nst 1nt1 1ntd 1nub 1nuc 1nue 1nul 1nvq 1nvr 1nvs 1nwo 1nwp 1nz2 1nz3 1nz4 1nz5 1nzr 1o0b 1o0c 1o1r 1o1s 1o1t 1o41 1o42 1o43 1o44 1o45 1o46 1o47 1o48 1o49 1o4a 1o4b 1o4c 1o4d 1o4e 1o4f 1o4g 1o4h 1o4i 1o4j 1o4k 1o4l 1o4m 1o4n 1o4o 1o4p 1o4q 1o4r 1o5m 1oaa 1oak 1oat 1obm 1obp 1obs 1obt 1occ 1oce 1oco 1ocr 1ocz 1odd 1ody 1oel 1oen 1ofj 1ofk 1ohr 1oib 1oil 1ois 1okl 1okm 1okn 1ome 1omp 1ona 1onc 1onr 1oop 1opa 1opb 1opd 1opf 1opr 1ops 1opy 1or2 1or3 1ord 1ork 1oro 1ort 1osa 1ose 1osi 1osj 1osm 1osp 1osz 1otf 1otg 1otp 1oua 1oub 1ouc 1oud 1oue 1ouf 1oug 1ouh 1oui 1ouj 1ovb 1ovt 1oxa 1oxm 1oxy 1oya 1oyb 1oyc 1oyq 1p18 1p1b 1p1c 1p1q 1p24 1p25 1p26 1p32 1p39 1p7l 1paf 1pag 1pah 1pam 1pau 1pax 1pbb 1pbc 1pbd 1pbf 1pbg 1pbi 1pbk 1pbn 1pbo 1pbp 1pbv 1pbw 1pch 1pci 1pcl 1pcr 1pda 1pdh 1pdo 1pdr 1pdy 1pdz 1pea 1ped 1pef 1pen 1pex 1pfo 1pfx 1pga 1pgb 1pge 1pgf 1pgg 1pgj 1pgn 1pgo 1pgp 1pgq 1phk 1phm 1phn 1pho 1php 1phr 1pht 1pif 1pig 1pii 1pil 1pin 1pio 1pip 1piv 1pjr 1pk7 1pk9 1pke 1pkm 1pkp 1plf 1plg 1plj 1plk 1pll 1plq 1plr 1plu 1pma 1pmd 1pme 1pmp 1pmt 1pmy 1pne 1pnf 1pnk 1pnt 1po1 1po2 1poa 1pob 1poc 1pod 1poe 1poh 1poi 1pop 1pos 1pov 1pow 1pox 1poy 1ppb 1ppc 1pph 1ppi 1ppl 1ppm 1ppr 1pr0 1pr1 1pr2 1pr4 1pr5 1pr6 1pr9 1prh 1prn 1pro 1prq 1prt 1prx 1psd 1psh 1psi 1psj 1psk 1psp 1pss 1pst 1ptd 1ptf 1ptg 1pth 1pto 1ptq 1ptr 1pts 1ptt 1ptu 1ptv 1ptx 1pty 1puc 1pud 1pva 1pvb 1pvc 1pvd 1pvu 1pw7 1pw9 1pwb 1pwl 1pwm 1pxa 1pxb 1pxc 1pxt 1pya 1pyd 1pyg 1pys 1pyt 1q6k 1q9d 1qa1 1qa2 1qa3 1qae 1qap 1qas 1qat 1qbe 1qbl 1qbm 1qbq 1qbr 1qbs 1qbt 1qbu 1qbv 1qcg 1qci 1qcj 1qcp 1qcq 1qcr 1qcu 1qcw 1qcx 1qd2 1qdr 1qdt 1qe1 1qe6 1qez 1qf0 1qf1 1qf2 1qf3 1qf9 1qgf 1qh9 1qhi 1qhr 1qil 1qke 1qnf 1qnm 1qor 1qp1 1qpa 1qpf 1qpg 1qph 1qpq 1qpr 1qps 1qpv 1qpw 1qq1 1qq4 1qqt 1qqu 1qr3 1qr4 1qra 1qrb 1qrc 1qrd 1qrh 1qri 1qrk 1qrw 1qrx 1qsa 1qsh 1qsi 1qsl 1qsw 1qt1 1qte 1qtf 1qti 1qtj 1qtq 1que 1quf 1qui 1quj 1quk 1qul 1qut 1qvc 1qx8 1r24 1r4r 1r5c 1r5d 1raa 1rab 1rac 1rad 1rae 1raf 1rag 1rah 1rai 1ral 1ram 1rbc 1rbd 1rbe 1rbf 1rbg 1rbh 1rbi 1rbl 1rbn 1rbo 1rbw 1rbx 1rcc 1rcd 1rce 1rcf 1rcg 1rci 1rcm 1rco 1rcp 1rcx 1rcy 1rdi 1rdj 1rdk 1rdl 1rdn 1rdo 1rdv 1rdx 1rdy 1rdz 1re2 1re8 1rea 1rec 1red 1ree 1ref 1reg 1rej 1rek 1rem 1rev 1rex 1rey 1rez 1rfb 1rfp 1rfs 1rg9 1rgs 1rh2 1rh4 1rhg 1rhi 1rhl 1rho 1rhp 1rib 1rin 1ris 1rla 1rlb 1rlc 1rld 1rlr 1rls 1rm1 1rmf 1rmg 1rmh 1rn1 1rne 1rnl 1rnm 1rnn 1rno 1rnq 1rnr 1rnu 1rnv 1rnw 1rnx 1rny 1rnz 1rom 1rpa 1rpl 1rpo 1rpt 1rq7 1rrf 1rrg 1rri 1rsc 1rss 1rst 1rsu 1rsy 1rt1 1rt2 1rt3 1rt4 1rt5 1rt6 1rt7 1rtb 1rtc 1rtf 1rtg 1rth 1rti 1rtj 1rtm 1rts 1rtu 1rve 1rvv 1rvw 1rxo 1ry0 1ry8 1ryc 1ryp 1ryt 1rzl 1s3o 1s3x 1s5i 1s6p 1s6q 1s9e 1s9g 1sac 1sat 1sbd 1sbe 1sbg 1sbh 1sbi 1sbs 1sce 1scf 1sch 1scm 1scr 1scs 1scu 1sda 1se2 1se3 1se4 1seb 1sei 1sek 1sel 1sem 1sep 1ses 1set 1sev 1sft 1sgf 1sgk 1sha 1shb 1shd 1shf 1shg 1shs 1shv 1sid 1sie 1siv 1sjs 1skf 1skj 1sky 1skz 1sla 1slb 1slc 1sld 1sle 1slf 1slg 1sli 1slm 1sln 1slt 1slu 1slv 1slw 1slx 1sly 1sm3 1sma 1smd 1sme 1smf 1smn 1smp 1smt 1smv 1sn1 1snb 1snd 1snk 1sno 1snp 1snq 1son 1soo 1sos 1sox 1spa 1spd 1spe 1spg 1sph 1spi 1spr 1sps 1sqc 1sra 1ssa 1ssb 1ssc 1st3 1sta 1stb 1stc 1std 1ste 1stg 1sth 1stm 1stn 1sto 1str 1sts 1sty 1sur 1suz 1sv5 1sva 1svp 1svy 1swa 1swb 1swc 1swd 1swe 1swf 1swh 1swi 1swj 1swk 1swl 1swn 1swo 1swp 1swq 1swr 1sx5 1sx8 1sxt 1syg 1syn 1szj 1szt 1t02 1t1d 1t1n 1t41 1t4i 1t4u 1t4v 1ta2 1ta6 1tad 1taf 1tag 1tah 1tal 1taq 1taw 1tay 1tbe 1tbg 1tbp 1tbq 1tbr 1tby 1tbz 1tca 1tcb 1tcc 1tcd 1tcf 1tco 1tcr 1tcw 1tcx 1tcy 1tda 1tdb 1tdc 1tde 1tdf 1tdu 1tdy 1teh 1tei 1tem 1ten 1tes 1tet 1tew 1tf4 1tfe 1tfg 1tfp 1tfx 1tgj 1tgk 1tgx 1the 1thg 1thj 1tho 1tht 1thx 1tia 1tif 1tig 1tii 1tip 1tis 1tjs 1tka 1tkb 1tkc 1tlf 1tmc 1tmh 1tmk 1tml 1tmo 1tmt 1tmu 1tnd 1tng 1tnh 1tni 1tnj 1tnk 1tnl 1tnr 1toc 1tom 1top 1tox 1tpd 1tpe 1tpf 1tps 1tpu 1tpv 1tpw 1tq9 1tr1 1trb 1trd 1tre 1trh 1tri 1trk 1trn 1ts2 1ts3 1ts4 1ts5 1tsh 1tsl 1tsm 1tsp 1tsv 1tsw 1tsx 1tsy 1tsz 1tti 1ttj 1ttp 1ttq 1tuc 1tud 1tux 1tvd 1tvr 1tvu 1tvv 1tvw 1tvx 1txr 1tyf 1tyn 1typ 1tys 1tyt 1tyu 1tyv 1tyw 1tyx 1tze 1u1i 1u1y 1u3l 1u40 1u43 1u9q 1u9w 1u9x 1uae 1uag 1ubn 1ubz 1uc0 1uch 1ucs 1ucw 1ucx 1ud1 1udg 1udh 1udi 1udr 1ue2 1uea 1uer 1ues 1uga 1ugb 1ugc 1ugd 1uge 1ugf 1ugg 1ugh 1ui7 1ui8 1uia 1uib 1uic 1uid 1uie 1uif 1uig 1uih 1uio 1uip 1uke 1ukq 1uks 1ukt 1uky 1ukz 1umu 1una 1une 1unk 1uok 1uor 1up1 1ura 1urb 1uri 1urp 1urt 1usn 1uvs 1uvt 1uvu 1uwb 1uxy 1v39 1v3b 1v3c 1v3d 1v3e 1v3j 1v3k 1v3l 1v3m 1v7s 1v7t 1v9u 1vac 1vad 1vah 1vai 1val 1vam 1vap 1var 1vba 1vbb 1vbc 1vbd 1vbe 1vbs 1vbt 1vca 1vcc 1vcj 1vcp 1vcq 1vdc 1vde 1vdr 1vfa 1vfb 1vfr 1vgc 1vhh 1vhi 1vhr 1vid 1vie 1vif 1vin 1vip 1vit 1vjs 1vjw 1vkl 1vkx 1vlb 1vln 1vls 1vlt 1vlx 1vmo 1vnc 1vne 1vnf 1vng 1vnh 1vni 1vns 1vok 1vot 1vp3 1vp9 1vpe 1vpf 1vpi 1vps 1vpt 1vqa 1vqb 1vqc 1vqd 1vqe 1vqf 1vqg 1vqh 1vqi 1vqj 1vrk 1vrt 1vru 1vsb 1vsc 1vsk 1vsl 1vsm 1vtk 1vtm 1vub 1vwa 1vwb 1vwc 1vwd 1vwe 1vwf 1vwg 1vwh 1vwi 1vwj 1vwk 1vwl 1vwm 1vwn 1vwo 1vwp 1vwq 1vwr 1vwt 1vxa 1vxb 1vxc 1vxd 1vxe 1vxf 1vxg 1vxh 1vza 1vzb 1vzc 1vzd 1vze 1vzv 1wab 1waf 1waj 1was 1wat 1wav 1wba 1wbc 1wbl 1wdc 1wdn 1wej 1wer 1wfa 1wfb 1wfc 1wgi 1wgj 1wgt 1whi 1whp 1wio 1wiq 1wkd 1wke 1wkf 1wmn 1wmo 1wmp 1wnt 1wod 1wpo 1wq1 1wqm 1wqn 1wqo 1wqp 1wqq 1wqr 1wsa 1wsd 1wtl 1wyk 1x11 1x6j 1x7a 1x81 1x96 1xaa 1xab 1xac 1xad 1xan 1xas 1xat 1xca 1xcj 1xcl 1xei 1xej 1xek 1xgm 1xgn 1xgo 1xgs 1xkb 1xkj 1xlm 1xnb 1xnc 1xnd 1xo0 1xpb 1xps 1xpt 1xra 1xrb 1xrc 1xsm 1xso 1xtc 1xuf 1xug 1xuh 1xui 1xuj 1xuk 1xva 1xwl 1xxa 1xxb 1xxc 1xxp 1xxt 1xy0 1xya 1xyb 1xyc 1xyl 1xym 1xyn 1xyo 1xyp 1xyz 1xz5 1xza 1xzb 1xzc 1xzd 1xze 1xzf 1xzg 1xzh 1xzi 1xzj 1xzk 1xzl 1xzm 1xzu 1xzv 1xzw 1y0a 1y0c 1y0d 1y0t 1y22 1y2z 1y31 1y35 1y45 1y46 1y4b 1y4f 1y4g 1y4p 1y4q 1y4r 1y4v 1y5f 1y5j 1y5k 1y7c 1y7d 1y7g 1y7z 1y83 1y85 1y8w 1yaa 1yac 1yal 1yam 1yan 1yao 1yap 1yaq 1yas 1ybv 1ycp 1ycq 1ycr 1ycs 1ydb 1ydc 1ydr 1yds 1ydt 1ydv 1ydz 1ye0 1ye1 1ye2 1yed 1yee 1yef 1yeg 1yeh 1yen 1yeo 1yeq 1yer 1yes 1yet 1yeu 1yev 1yfe 1yfm 1yfo 1yg5 1ygd 1yge 1ygf 1ygp 1ygs 1yh9 1yha 1yhe 1yhr 1yie 1yih 1yja 1yjb 1yjc 1yk8 1ykf 1ymu 1ymv 1yna 1yog 1yoh 1yoi 1yoo 1ypn 1ypr 1ypt 1yqv 1yso 1yst 1ytc 1ytg 1yth 1yti 1ytj 1ytn 1yts 1ytt 1ytw 1yve 1yvs 1yyd 1yyy 1z1h 1z1r 1z3n 1z6p 1z6q 1zak 1zap 1zen 1zg4 1zg6 1zid 1zin 1zio 1zip 1znb 1znc 1zon 1zoo 1zop 1zpr 1zrm 1zrn 1zsa 1zsb 1zsc 1zxq 1zym 1zys 1zzz 208l 20gs 221p 22gs 2a0p 2a2q 2a4g 2a4q 2a4r 2aac 2aai 2aak 2abh 2abk 2abl 2ace 2acg 2acq 2acr 2acs 2acu 2ada 2adm 2ae1 2aer 2afn 2aid 2aig 2aim 2ak2 2ak3 2aky 2alr 2ame 2amg 2amv 2anh 2ans 2aop 2ara 2arc 2asi 2asr 2at2 2at9 2av8 2avi 2awz 2ax0 2ax1 2axm 2ay1 2ay2 2ay3 2ay4 2ay5 2ay6 2ay7 2ay8 2ay9 2azo 2azu 2b53 2b54 2b8o 2baa 2bam 2bat 2bb2 2bbq 2bc2 2bdp 2bef 2bgt 2bgu 2bif 2bir 2bmh 2bnh 2bpp 2bpv 2bpw 2bpx 2bpy 2bpz 2bqa 2bqb 2bqc 2bqd 2bqe 2bqf 2bqg 2bqh 2bqi 2bqj 2bqk 2bql 2bqm 2bqn 2bqo 2bqp 2bsp 2btc 2btf 2btv 2bvv 2cag 2cah 2can 2cas 2cbl 2cbs 2cel 2cgp 2cgr 2chb 2chr 2chs 2cht 2clr 2cmd 2cmm 2cnd 2cpl 2cpo 2crx 2csm 2csn 2ctv 2cut 2cwg 2cxb 2cy3 2cyh 2cym 2d3f 2d3h 2d4i 2d4j 2d4k 2daa 2dab 2dap 2dbl 2dbv 2dhn 2dlf 2dln 2dn2 2dn3 2dor 2dpg 2dqt 2dqu 2dri 2dtr 2dub 2dyn 2e2c 2ebn 2eck 2eip 2emd 2emo 2enb 2enr 2eql 2erc 2erk 2euh 2exm 2exo 2f38 2f58 2f8w 2f9u 2f9v 2fap 2fax 2fdx 2fgw 2fhi 2fib 2fir 2fit 2fiv 2flb 2flr 2flv 2fm2 2fmb 2fok 2fox 2fua 2fus 2fvx 2g91 2gac 2gal 2gar 2gaw 2gep 2gfb 2glr 2glt 2gmf 2gpa 2grt 2gsa 2gsp 2gsr 2gtu 2gvf 2gyi 2h1p 2h4n 2h5l 2h8d 2h8f 2hbc 2hbd 2hbe 2hbf 2hbs 2hck 2hea 2heb 2hec 2hed 2hee 2hef 2hft 2his 2hlc 2hmb 2hnp 2hnq 2hoh 2hpd 2hrp 2hsd 2hts 2hwz 2iff 2ifm 2ifn 2ila 2int 2iot 2ipp 2iza 2izb 2izc 2izd 2ize 2izf 2izg 2izh 2izi 2izj 2izk 2izl 2jcw 2jdw 2jdx 2jel 2jia 2kau 2kce 2kfn 2kfz 2ki5 2kmb 2kzm 2kzz 2lao 2lbd 2lgs 2lig 2lip 2ljr 2lkf 2lve 2lyo 2mas 2mbr 2mbw 2mea 2meb 2mec 2med 2mee 2mef 2meg 2meh 2mei 2mgd 2mge 2mgf 2mgg 2mgi 2mgj 2mgk 2mgl 2mgm 2mha 2mib 2min 2mip 2mnr 2mpr 2ms2 2msb 2msi 2msj 2mta 2mya 2myb 2myc 2myd 2mye 2nck 2ngr 2nod 2nos 2np1 2npx 2nrd 2nse 2nsi 2nu0 2nu1 2nu2 2nu3 2nu4 2nuc 2nul 2o7c 2oat 2obo 2obq 2oc0 2oc1 2oc7 2oc8 2occ 2ohx 2omf 2oro 2orp 2orq 2orr 2ors 2ort 2otc 2oxi 2paw 2pax 2pbg 2pcc 2pcp 2pda 2pec 2pf2 2pgd 2pgh 2pgi 2pgt 2phi 2phy 2pii 2pil 2piy 2piz 2pj0 2pj1 2pj2 2pj3 2pj4 2pj5 2pj6 2pj7 2pj8 2pj9 2pja 2pjb 2pjc 2plc 2plt 2pmt 2pol 2prc 2prg 2psp 2ptd 2pth 2ptk 2pvi 2pyp 2pyr 2qg9 2qgf 2qil 2qwa 2qwb 2qwc 2qwd 2qwe 2qwf 2qwg 2qwh 2qwi 2qwj 2qwk 2rac 2ran 2rap 2rdv 2reb 2ren 2rla 2rln 2rma 2rmb 2rmc 2rmp 2rns 2rsl 2rta 2rtb 2rtc 2rtd 2rte 2rtf 2rtg 2rth 2rti 2rtj 2rtk 2rtl 2rtm 2rtn 2rto 2rtp 2rtq 2rtr 2sak 2sam 2sas 2sba 2sbl 2seb 2sfp 2shp 2sil 2siv 2skc 2skd 2ske 2sli 2snm 2snv 2snw 2spc 2spg 2spl 2spm 2spo 2src 2sta 2stb 2std 2tcl 2tct 2tdd 2tdt 2tdx 2tir 2tmd 2tmg 2tmk 2tnf 2tpr 2trc 2trh 2trs 2try 2tsa 2tsb 2tsr 2tsy 2tys 2ucz 2ukd 2ull 2usn 2vaa 2vab 2vgc 2vir 2vis 2vit 2viu 2vp3 2vpf 2vtk 2vub 2wbc 2wea 2web 2wec 2wed 2wsy 2xat 2xyl 2ygs 2ypn 2znb 2znc 2zoc 305d 306d 312d 316d 328d 329d 32c2 333d 334d 335d 337d 338d 339d 340d 341d 342d 343d 345d 346d 354d 359d 364d 379d 382d 383d 3abn 3aid 3aig 3aky 3ame 3amv 3asn 3aso 3azu 3b8d 3bam 3bdp 3bif 3bjl 3btd 3bte 3btf 3btg 3bth 3btk 3btm 3btq 3btt 3btw 3c1k 3c8q 3caa 3ccx 3cd4 3cel 3cgt 3cox 3crx 3csm 3cyr 3daa 3dap 3dbv 3dhe 3eca 3era 3erk 3eyd 3f58 3fc1 3fib 3fis 3fit 3fiv 3fua 3g5e 3gal 3gar 3geo 3grt 3gsp 3gtu 3h1c 3h8a 3hdd 3hhr 3hip 3hoh 3hsc 3hud 3hvt 3ifm 3ik8 3ikd 3ink 3jdw 3kap 3kaq 3kbp 3kmb 3kn2 3knx 3kry 3kvt 3lad 3lbd 3ljr 3lkf 3lon 3lox 3lyo 3lz2 3mag 3mct 3mds 3min 3msi 3ng1 3nll 3nod 3np1 3ns7 3nse 3nuc 3nul 3och 3om9 3pax 3pdm 3pga 3pgt 3pmg 3pnp 3prc 3pro 3ptd 3pte 3qxf 3r49 3r4g 3r54 3r56 3r57 3r59 3rcf 3rcg 3rci 3rck 3rcl 3rd9 3rda 3rdb 3rdc 3rdd 3rhn 3rla 3rn8 3roc 3rti 3rtj 3sdh 3sdp 3sli 3sod 3srn 3ssi 3tat 3tdt 3tf4 3tgi 3tgj 3tgk 3thi 3tlh 3tmk 3tss 3ukd 3ull 3v9y 3vgc 3vsb 3vtk 3vu8 3vub 3wg7 3wn8 3x2q 3yas 3znb 3znc 413d 419d 421p 422d 428d 433d 440d 441d 442d 443d 444d 445d 447d 448d 449d 455d 479d 480d 483d 488d 4aig 4ake 4ame 4azu 4bdp 4bjl 4caa 4ccx 4cel 4cgt 4crx 4daa 4dbv 4dcg 4dh0 4eca 4erc 4erk 4fis 4fit 4fiv 4fua 4fxc 4gal 4gep 4grt 4gsa 4gsp 4gss 4gtu 4gxo 4hb1 4hbi 4hoh 4icb 4ifm 4ixd 4jdw 4k9h 4kbp 4kmb 4kng 4l7q 4l8f 4l8w 4l8y 4l95 4lbd 4ltd 4lyo 4mmm 4msi 4mt2 4nll 4nnr 4np1 4nse 4nul 4pax 4pbg 4pga 4pgt 4pnp 4pro 4rhn 4rla 4sdh 4sli 4srn 4tf4 4thi 4tmt 4tmv 4tmw 4tss 4tsv 4ukd 4vgc 4vub 4yas 4znb 521p 5azu 5bir 5bj4 5cel 5cgt 5cna 5cp4 5crx 5csm 5eaa 5eas 5eat 5eau 5fd1 5fit 5fiv 5fwg 5gal 5grt 5gsp 5gss 5hbi 5hoh 5jdw 5lym 5msi 5nll 5nse 5nuc 5nul 5pal 5pgm 5pnt 5prc 5ptd 5rhn 5rla 5tgl 5tss 5u52 5ubo 5ukd 5ull 5yas 621p 6ald 6ame 6cel 6cgt 6ebx 6fab 6fit 6fiv 6gsp 6gss 6hbi 6jdw 6msi 6nse 6nul 6pax 6prc 6ptd 6rhn 6rlx 6yas 721p 7acn 7ahl 7ame 7cei 7cel 7cgt 7cpa 7fab 7gep 7gsp 7gss 7hbi 7jdw 7msi 7nn9 7nse 7prc 7ptd 7tim 7yas 821p 830c 8acn 8ame 8cho 8cpa 8fab 8gep 8gss 8jdw 8msi 8nse 8ohm 8prk 8ruc 966c 9ame 9atc 9gss 9icw 9jdw 9msi 9nse 9pai

X-PLOR/CNS

357d

X-sight

1vkg 2b7d

X2DF

4j1g

XCALIBRE

1gg6 1ggd

XDS

5hek 5hfj

XFIT

1usz 5fax 5fbz 5w26 5w2u 5w2w 5w2y

XSIGHT

1agq

XTAL

1fix

XTAL3.0

1cwr 1cws 1cwt 1qb0

XTALVIEW

5b0w 5etz 5ffn

Xpleo

3r8e

and

1knc

auto

4k89 4rk8 4rka 4rli 4rr4

autoBUSTER

3u4o 3u4r

autoSHARP

2cgl 5g23

bp3

3imi

ccp4:

4dbm

dphases

1m7x

dynamiX

3qob

il

2z53

model

4j5k

mol

4rm2

mrbump/molrep

4e0b

mrx

3lvb

not

1ywb 2o85 3od3

other jiffy programs

1uf2

phasing

1pzf 1pzg

phenix/autosol

4lm8

pirate

2jhp 2vkz

qfit

3pj0

shake

1lkv 1ynk

sir

3gcg

starting

2h5d

structure

3i69

swiss-model

3he8 3hee

warpntrace

1l0i


Last modification: Thu May 23 08:41:55 CEST 2024